FHOD3 (NM_025135) Human Tagged ORF Clone

CAT#: RC221215

FHOD3 (Myc-DDK-tagged)-Human formin homology 2 domain containing 3 (FHOD3)

Change vector?

USD 1,999


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FHOD3 (NM_025135) Human Tagged ORF Clone
Symbol FHOD3
Synonyms FHOS2; Formactin2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC221215 representing NM_025135
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACGCTGGCTTGCCGGGTGCAGTTCTTGGACGACACGGACCCTTTCAACAGCACCAACTTCCCCG
AGCCCAGCCGGCCGCCGCTGTTCACGTTCCGCGAGGACCTCGCGCTCGGCACCCAGCTGGCGGGGGTCCA
TAGGCTGCTGCAGGCGCCGCACAAGCTGGATGACTGTACTCTGCAGCTCTCTCACAATGGCGCCTACCTG
GATTTGGAGGCCACCCTGGCAGAGCAGCGGGATGAGTTGGAAGGCTTCCAGGATGACGCCGGGCGGGGCA
AGAAGCACAGCATCATCCTAAGGACGCAGCTGTCTGTGAGGGTCCATGCCTGCATCGAAAAACTATACAA
CTCCAGCGGACGAGATTTGAGAAGGGCCCTCTTCTCCCTGAAGCAGATATTTCAGGATGACAAGGATTTG
GTGCATGAATTTGTAGTGGCTGAAGGTCTGACATGTTTGATCAAGGTGGGAGCTGAGGCTGATCAGAACT
ATCAGAACTACATCTTAAGGGCTTTGGGCCAGATTATGTTGTATGTGGATGGAATGAATGGAGTAATAAA
CCGCAATGAAACCATTCAGTGGCTGTACACTCTCATTGGGTCAAAGTTCCGCCTGGTGGTGAAGACAGCC
CTGAAGCTGCTGCTCGTCTTTGTAGAGTACTCGGAGTCCAACGCACCTCTCCTAATTCAGGCTGTCACTG
CTGTTGACACGAAAAGAGGGGTCAAACCTTGGTCAAATATCATGGAAATCCTGGAGGAAAAAGATGGAGT
TGATACGGAGCTACTGGTTTATGCAATGACTTTGGTGAACAAGACGTTATCAGGACTACCAGACCAAGAC
ACCTTCTACGACGTCGTGGACTGCCTGGAGGAGCTGGGCATTGCTGCTGTGTCCCAGAGGCACTTGAACA
AGAAAGGGACTGACCTGGACTTAGTGGAGCAACTCAACATTTATGAGGTGGCGCTCAGGCACGAGGATGG
CGATGAGACCACGGAGCCACCCCCCAGTGGGTGCCGGGACCGGAGGAGGGCCAGCGTGTGTTCCAGTGGC
GGAGGCGAGCACCGGGGCCTGGACCGCAGAAGGAGCCGCAGGCACTCGGTGCAGAGCATCAAGAGCACCC
TGTCGGCCCCCACCAGTCCCTGCTCCCAGTCAGCTCCCAGCTTCAAGCCCAACCAAGTGCGAGATCTGCG
TGAAAAATACAGCAATTTTGGCAATAACTCTTATCACTCCTCAAGACCCTCATCTGGATCCAGTGTGCCC
ACCACCCCCACATCATCCGTCTCACCCCCACAGGAGGCCAGGTTGGAAAGGTCATCACCGAGTGGTCTTC
TCACATCATCCTTCAGGCAGCACCAAGAGTCACTGGCAGCAGAGAGAGAGAGGCGGCGGCAGGAGAGAGA
AGAAAGGTTGCAGAGAATAGAGCGGGAAGAAAGAAACAAATTCAGCCGAGATTATTTAGACAAAAGAGAG
GAGCAAAGGCAAGCAAGAGAAGAAAGATACAAATACTTGGAACAGTTGGCAGCTGAGGAGCACGAGAAGG
AGCTGAGAAGCCGGAGTGTGAGCCGGGGCAGAGCCGACCTCTCCTTGGACCTGACCTCGCCAGCAGCCCC
AGCCTGCCTGGCTCCTCTGAGCCATAGCCCCTCATCTTCAGACTCTCAAGAGGCTCTCACGGTGTCTGCC
TCCTCCCCAGGAACCCCTCACCATCCCCAAGCAAGTGCCGGGGATCCTGAACCCGAATCAGAGGCAGAAC
CGGAAGCAGAGGCAGGGGCGGGGCAGGTTGCTGATGAAGCTGGCCAGGACATAGCCTCTGCCCACGAGGG
TGCAGAGACTGAAGTGGAGCAGGCACTAGAGCAAGAGCCGGAAGAAAGAGCCTCCCTCAGTGAAAAAGAG
AGGCAGAACGAGGGGGTGAACGAGAGGGACAACTGCTCTGCCTCCAGCGTCTCGTCCTCCAGCAGCACGT
TGGAGAGGGAGGAGAAGGAGGACAAGCTCTCCAGGGACAGGACAACTGGTTTGTGGCCCGCAGGTGTCCA
GGATGCAGGTGTAAATGGACAGTGTGGCGACATCCTCACCAACAAACGGTTCATGCTTGACATGCTGTAT
GCCCATAACAGGAAGTCTCCGGATGATGAGGAGAAGGGGGATGGGGAGGCTGGGAGGACCCAGCAGGAGG
CAGAGGCGGTAGCCAGCCTTGCTACCAGGATATCCACCCTGCAGGCCAACTCTCAGACCCAGGATGAGAG
TGTCAGGAGGGTGGATGTCGGCTGTTTGGACAATCGGGGCAGTGTGAAAGCATTTGCTGAGAAATTCAAC
AGTGGGGACCTGGGGAGAGGTTCCATCTCCCCTGATGCTGAGCCCAATGACAAGGTCCCAGAAACAGCGC
CGGTGCAGCCGAAGACAGAGTCTGATTACATCTGGGACCAGCTCATGGCCAATCCAAGAGAGCTCAGAAT
CCAAGACATGGATTTCACTGACCTGGGGGAGGAGGATGACATTGATGTCCTAGATGTGGACCTGGGTCAC
AGGGAGGCCCCTGGGCCACCTCCCCCACCCCCACCCACCTTTCTGGGTTTGCCGCCCCCACCCCCTCCGC
CCCTGTTGGACAGCATTCCTCCCCCTCCTGTCCCTGGTAATTTATTGGTTCCTCCTCCTCCAGTGTTCAA
CGCTCCTCAGGGCTTAGGGTGGTCCCAGGTACCCAGGGGTCAGCCCACATTCACTAAGAAAAAGAAGACC
ATCCGTTTGTTCTGGAATGAAGTTCGGCCTTTTGACTGGCCATGTAAAAACAACCGACGCTGCAGAGAAT
TCCTGTGGTCAAAACTGGAACCCATTAAGGTGGACACTTCCAGACTGGAGCACCTGTTTGAGTCTAAATC
CAAGGAACTGTCTGTCTCAAAGAAAACTGCTGCAGATGGAAAAAGGCAAGAGATCATTGTTCTGGATTCC
AAGAGGAGTAACGCCATCAATATTGGTCTGACGGTGCTGCCCCCTCCAAGGACGATTAAGATCGCCATTT
TGAATTTTGATGAGTATGCCTTAAACAAAGAAGGAATCGAGAAAATTCTAACGATGATTCCCACCGATGA
GGAGAAGCAGAAAATCCAGGAAGCTCAGCTGGCCAACCCTGAAATCCCCCTGGGCAGTGCAGAGCAGTTC
CTCCTCACCCTGTCCTCCATCAGCGAGCTCTCTGCACGACTTCACCTCTGGGCATTCAAAATGGATTATG
AAACTACAGAAAAGGAAGTAGCAGAACCACTCCTGGACCTGAAGGAAGGAATAGACCAGTTGGAGAACAA
TAAAACCTTGGGCTTTATCCTGTCTACTCTCTTAGCCATTGGGAACTTTCTAAATGGAACTAATGCCAAA
GCGTTTGAGTTAAGCTACCTCGAGAAGGTTCCAGAAGTCAAAGACACAGTGCACAAGCAGTCGCTTCTCC
ACCATGTGTGCACCATGGTGGTAGAAAACTTCCCAGACAGCTCCGATCTGTACTCGGAGATCGGGGCCAT
CACCAGGTCAGCCAAGGTTGACTTTGATCAACTTCAGGATAATTTATGTCAGATGGAGAGAAGATGCAAA
GCTTCATGGGATCACCTCAAGGCAATTGCAAAACATGAAATGAAACCAGTTTTAAAACAACGGATGTCAG
AGTTCCTGAAAGACTGTGCAGAGCGAATTATAATTTTAAAGATTGTCCATAGAAGGATAATCAACAGATT
CCACTCCTTTTTACTCTTTATGGGCCATCCACCTTATGCAATTCGGGAAGTGAACATAAACAAATTCTGC
AGGATTATTAGTGAATTTGCACTAGAGTATCGCACAACCAGGGAAAGGGTTTTGCAGCAGAAACAGAAAC
GGGCCAACCACAGAGAGAGAAATAAGACCAGAGGGAAGATGATCACCGATTCTGGCAAGTTCTCCGGCAG
TTCTCCGGCGCCCCCAAGCCAGCCGCAGGGTCTGAGCTATGCGGAGGACGCGGCTGAGCACGAGAACATG
AAGGCTGTGCTGAAAACCTCGTCCCCCTCCGTGGAGGACGCCACCCCCGCGCTGGGCGTCCGCACACGCA
GCCGAGCAAGCCGAGGATCCACTAGTTCCTGGACTATGGGAACTGATGACTCGCCCAATGTCACAGATGA
TGCAGCTGATGAGATCATGGACCGCATCGTCAAGTCAGCCACCCAAGTGCCCAGTCAGCGAGTGGTGCCG
AGGGAGAGGAAACGATCCCGGGCCAACCGGAAATCTTTGCGAAGAACCCTGAAGAGCGGCCTGACCCCAG
AAGAAGCCAGAGCCCTGGGCTTGGTTGGCACCTCGGAGTTGCAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221215 representing NM_025135
Red=Cloning site Green=Tags(s)

MATLACRVQFLDDTDPFNSTNFPEPSRPPLFTFREDLALGTQLAGVHRLLQAPHKLDDCTLQLSHNGAYL
DLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDL
VHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTA
LKLLLVFVEYSESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQD
TFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSG
GGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQVRDLREKYSNFGNNSYHSSRPSSGSSVP
TTPTSSVSPPQEARLERSSPSGLLTSSFRQHQESLAAERERRRQEREERLQRIEREERNKFSRDYLDKRE
EQRQAREERYKYLEQLAAEEHEKELRSRSVSRGRADLSLDLTSPAAPACLAPLSHSPSSSDSQEALTVSA
SSPGTPHHPQASAGDPEPESEAEPEAEAGAGQVADEAGQDIASAHEGAETEVEQALEQEPEERASLSEKE
RQNEGVNERDNCSASSVSSSSSTLEREEKEDKLSRDRTTGLWPAGVQDAGVNGQCGDILTNKRFMLDMLY
AHNRKSPDDEEKGDGEAGRTQQEAEAVASLATRISTLQANSQTQDESVRRVDVGCLDNRGSVKAFAEKFN
SGDLGRGSISPDAEPNDKVPETAPVQPKTESDYIWDQLMANPRELRIQDMDFTDLGEEDDIDVLDVDLGH
REAPGPPPPPPPTFLGLPPPPPPPLLDSIPPPPVPGNLLVPPPPVFNAPQGLGWSQVPRGQPTFTKKKKT
IRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDS
KRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKILTMIPTDEEKQKIQEAQLANPEIPLGSAEQF
LLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAK
AFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCK
ASWDHLKAIAKHEMKPVLKQRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFC
RIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYAEDAAEHENM
KAVLKTSSPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTDDAADEIMDRIVKSATQVPSQRVVP
RERKRSRANRKSLRRTLKSGLTPEEARALGLVGTSELQL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_025135
ORF Size 4317 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_025135.2, NM_025135.3, NM_025135.4, NP_079411
RefSeq Size 4942
RefSeq ORF 4320
Locus ID 80206
Cytogenetics 18q12.2
Domains FH2
MW 160.6 kDa
Gene Summary The protein encoded by this gene is a member of the diaphanous-related formins (DRF), and contains multiple domains, including GBD (GTPase-binding domain), DID (diaphanous inhibitory domain), FH1 (formin homology 1), FH2 (formin homology 2), and DAD (diaphanous auto-regulatory domain) domains. This protein is thought to play a role in actin filament polymerization in cardiomyocytes. Mutations in this gene have been associated with dilated cardiomyopathy (DCM), characterized by dilation of the ventricular chamber, leading to impairment of systolic pump function and subsequent heart failure. Increased levels of the protein encoded by this gene have been observed in individuals with hypertrophic cardiomyopathy (HCM). Alternative splicing results in multiple transcript variants encoding different isoforms. A muscle-specific isoform has been shown to possess a casein kinase 2 (CK2) phosphorylation site at the C-terminal end of the FH2 domain. Phosphorylation of this site alters its interaction with sequestosome 1 (SQSTM1), and targets this isoform to myofibrils, while other isoforms form cytoplasmic aggregates. [provided by RefSeq, Aug 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations