NDRG4 (NM_020465) Human Tagged ORF Clone

CAT#: RC221058

Reviews ()
Write a review

NDRG4 (Myc-DDK-tagged)-Human NDRG family member 4 (NDRG4), transcript variant 1



Reconstitution Protocol

USD 457.00

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NDRG4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NDRG4
Synonyms BDM1; SMAP-8; SMAP8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221058 representing NM_020465
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGGCTGCAGGAGCTGCGATTCCCTGAGGAGAAGCCGCTGCTCCGGGGCCAGGACGCCACCGAGC
TGGAGAGCTCCGATGCCTTCCTCTTGGCTGCAGACACAGACTGGAAGGAACATGACATCGAGACACCCTA
CGGCCTTCTGCATGTAGTGATCCGGGGCTCCCCCAAGGGGAACCGCCCAGCCATCCTCACCTACCATGAT
GTGGGCCTCAACCACAAACTATGCTTCAACACCTTCTTCAACTTCGAGGACATGCAGGAGATCACCAAGC
ACTTTGTGGTGTGTCACGTGGATGCCCCTGGACAACAGGTGGGGGCGTCGCAGTTTCCTCAGGGGTACCA
GTTCCCCTCCATGGAGCAGCTGGCTGCCATGCTCCCCAGCGTGGTGCAGCATTTCGGGTTCAAGTATGTG
ATTGGCATCGGAGTGGGCGCCGGAGCCTATGTGCTGGCCAAGTTTGCACTCATCTTCCCCGACCTGGTGG
AGGGGCTGGTGCTGGTGAACATCGACCCCAATGGCAAAGGCTGGATAGACTGGGCTGCCACCAAGCTCTC
CGGCCTAACTAGCACTTTACCCGACACGGTGCTCTCCCACCTCTTCAGCCAGGAGGAGCTGGTGAACAAC
ACAGAGTTGGTGCAGAGCTACCGGCAGCAGATTGGGAACGTGGTGAACCAGGCCAACCTGCAGCTCTTCT
GGAACATGTACAACAGCCGCAGAGACCTGGACATTAACCGGCCTGGAACGGTGCCCAATGCCAAGACGCT
CCGCTGCCCCGTGATGCTGGTGGTTGGGGATAATGCACCCGCTGAGGACGGGGTGGTGGAGTGCAACTCC
AAACTGGACCCGACCACTACGACCTTCCTGAAGATGGCAGACTCTGGAGGGCTGCCCCAGGTCACACAGC
CAGGGAAGCTGACTGAAGCCTTCAAATACTTCCTGCAAGGCATGGGCTACATGCCCTCAGCCAGCATGAC
CCGCCTGGCACGCTCCCGCACTGCATCCCTCACCAGTGCCAGCTCGGTGGATGGCAGCCGCCCACAGGCC
TGCACCCACTCGGAGAGCAGCGAGGGGCTGGGCCAGGTCAACCACACCATGGAGGTGTCCTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221058 representing NM_020465
Red=Cloning site Green=Tags(s)

MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGNRPAILTYHD
VGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYV
IGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNN
TELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNS
KLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQA
CTHSESSEGLGQVNHTMEVSC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020465
ORF Size 1113 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020465.4
RefSeq Size 3288 bp
RefSeq ORF 1116 bp
Locus ID 65009
UniProt ID Q9ULP0
Cytogenetics 16q21
Domains Ndr
MW 40.5 kDa
Gene Summary This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.[provided by RefSeq, Jun 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.