Integrin alpha 3 (ITGA3) (NM_005501) Human Tagged ORF Clone

CAT#: RC220975

Reviews ()
Write a review

ITGA3 (Myc-DDK-tagged)-Human integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor) (ITGA3), transcript variant b



  "NM_005501" in other vectors (4)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 1,190.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Integrin alpha 3 (ITGA3) (NM_005501) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGA3
Synonyms CD49C; GAP-B3; GAPB3; ILNEB; MSK18; VCA-2; VL3A; VLA3a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC220975 representing NM_005501
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCCCGGCCCCAGCCGCGCGCCCCGCGCCCCACGCCTGATGCTCTGTGCGCTCGCCTTGATGGTGG
CGGCCGGCGGCTGCGTCGTCTCCGCCTTCAACCTGGATACCCGATTCCTGGTAGTGAAGGAGGCCGGGAA
CCCGGGCAGCCTCTTCGGCTACTCGGTCGCCCTCCATCGGCAGACAGAGCGGCAGCAGCGCTACCTGCTC
CTGGCTGGTGCCCCCCGGGAGCTCGCTGTGCCCGATGGCTACACCAACCGGACTGGTGCTGTGTACCTGT
GCCCACTCACTGCCCACAAGGATGACTGTGAGCGGATGAACATCACAGTGAAAAATGACCCTGGCCATCA
CATTATTGAGGACATGTGGCTTGGAGTGACTGTGGCCAGCCAGGGCCCTGCAGGCAGAGTTCTGGTCTGT
GCCCACCGCTACACCCAGGTGCTGTGGTCAGGGTCAGAAGACCAGCGGCGCATGGTGGGCAAGTGCTACG
TGCGAGGCAATGACCTAGAGCTGGACTCCAGTGATGACTGGCAGACCTACCACAACGAGATGTGCAATAG
CAACACAGACTACCTGGAGACGGGCATGTGCCAGCTGGGCACCAGCGGTGGCTTCACCCAGAACACTGTG
TACTTCGGCGCCCCCGGTGCCTACAACTGGAAAGGAAACAGCTACATGATTCAGCGCAAGGAGTGGGACT
TATCTGAGTATAGTTACAAGGACCCAGAGGACCAAGGAAACCTCTATATTGGGTACACGATGCAGGTAGG
CAGCTTCATCCTGCACCCCAAAAACATCACCATTGTGACAGGTGCCCCACGGCACCGACATATGGGCGCG
GTGTTCTTGCTGAGCCAGGAGGCAGGCGGAGACCTGCGGAGGAGGCAGGTGCTGGAGGGCTCGCAGGTGG
GCGCCTATTTTGGCAGCGCCATTGCCCTGGCAGACCTGAACAATGATGGGTGGCAGGACCTCCTGGTGGG
CGCCCCCTACTACTTTGAGAGGAAAGAGGAAGTAGGGGGTGCCATCTATGTCTTCATGAACCAGGCGGGA
ACCTCCTTCCCTGCTCACCCCTCACTCCTTCTTCATGGCCCCAGTGGCTCTGCCTTTGGTTTATCTGTGG
CCAGCATTGGTGACATCAACCAGGATGGATTTCAGGATATTGCTGTGGGAGCTCCGTTTGAAGGCTTGGG
CAAAGTGTACATCTATCACAGTAGCTCTAAGGGGCTCCTCAGACAGCCCCAGCAGGTAATCCATGGAGAG
AAGCTGGGACTGCCTGGGTTGGCCACCTTCGGCTATTCCCTCAGTGGGCAGATGGATGTGGATGAGAACT
TCTACCCAGACCTTCTAGTGGGAAGCCTGTCAGACCACATTGTGCTGCTGCGGGCCCGGCCCGTCATCAA
CATCGTCCACAAGACCTTGGTGCCCAGGCCAGCTGTGCTGGACCCTGCACTTTGCACGGCCACCTCTTGT
GTGCAAGTGGAGCTGTGCTTTGCTTACAACCAGAGTGCCGGGAACCCCAACTACAGGCGAAACATCACCC
TGGCCTACACTCTGGAGGCTGACAGGGACCGCCGGCCGCCCCGGCTCCGCTTTGCCGGCAGTGAGTCCGC
TGTCTTCCACGGCTTCTTCTCCATGCCCGAGATGCGCTGCCAGAAGCTGGAGCTGCTCCTGATGGACAAC
CTCCGTGACAAACTCCGCCCCATCATCATCTCCATGAACTACTCTTTACCTTTGCGGATGCCCGATCGCC
CCCGGCTGGGGCTGCGGTCCCTGGACGCCTACCCGATCCTCAACCAGGCACAGGCTCTGGAGAACCACAC
TGAGGTCCAGTTCCAGAAGGAGTGCGGGCCTGACAACAAGTGTGAGAGCAACTTGCAGATGCGGGCAGCC
TTCGTGTCAGAGCAGCAGCAGAAGCTGAGCAGGCTCCAGTACAGCAGAGACGTCCGGAAATTGCTCCTGA
GCATCAACGTGACGAACACCCGGACCTCGGAGCGCTCCGGGGAGGACGCCCACGAGGCGCTGCTCACCCT
GGTGGTGCCTCCCGCCCTGCTGCTGTCCTCAGTGCGCCCCCCCGGGGCCTGCCAAGCTAATGAGACCATC
TTTTGCGAGCTGGGGAACCCCTTCAAACGGAACCAGAGGATGGAGCTGCTCATCACCTTTGAGGTCATCG
GGGTGACCCTGCACACAAGGGACCTTCAGGTGCAGCTGCAGCTCTCCACGTCGAGTCACCAGGACAACCT
GTGGCCCATGATCCTCACTCTGCTGGTGGACTATACACTCCAGACCTCGCTTAGCATGGTAAATCACCGG
CTACAAAGCTTCTTTGGGGGGACAGTGATGGGTGAGTCTGGCATGAAAACTGTGGAGGATGTAGGAAGCC
CCCTCAAGTATGAATTCCAGGTGGGCCCAATGGGGGAGGGGCTGGTGGGCCTGGGGACCCTGGTCCTAGG
TCTGGAGTGGCCCTACGAAGTCAGCAATGGCAAGTGGCTGCTGTATCCCACGGAGATCACCGTCCATGGC
AATGGGTCCTGGCCCTGCCGACCACCTGGAGACCTTATCAACCCTCTCAACCTCACTCTTTCTGACCCTG
GGGACAGGCCATCATCCCCACAGCGCAGGCGGCGACAGCTGGATCCAGGGGGAGGCCAGGGCCCCCCACC
TGTCACTCTGGCTGCTGCCAAAAAAGCCAAGTCTGAGACTGTGCTGACCTGTGCCACAGGGCGTGCCCAC
TGTGTGTGGCTAGAGTGCCCCATCCCTGATGCCCCCGTTGTCACCAACGTGACTGTGAAGGCACGAGTGT
GGAACAGCACCTTCATCGAGGATTACAGAGACTTTGACCGAGTCCGGGTAAATGGCTGGGCTACCCTATT
CCTCCGAACCAGCATCCCCACCATCAACATGGAGAACAAGACCACGTGGTTCTCTGTGGACATTGACTCG
GAGCTGGTGGAGGAGCTGCCGGCCGAAATCGAGCTGTGGCTGGTGCTGGTGGCCGTGGGTGCAGGGCTGC
TGCTGCTGGGGCTGATCATCCTCCTGCTGTGGAAGTGTGACTTCTTTAAGCGGACCCGCTATTATCAGAT
CATGCCCAAGTACCACGCAGTGCGGATCCGGGAGGAGGAGCGCTACCCACCTCCAGGGAGCACCCTGCCC
ACCAAGAAGCACTGGGTGACCAGCTGGCAGACTCGGGACCAATACTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220975 representing NM_005501
Red=Cloning site Green=Tags(s)

MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLL
LAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVC
AHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTV
YFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGA
VFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAG
TSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSC
VQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDN
LRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAA
FVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETI
FCELGNPFKRNQRMELLITFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHR
LQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAH
CVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFSVDIDS
ELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCDFFKRTRYYQIMPKYHAVRIREEERYPPPGSTLP
TKKHWVTSWQTRDQYY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005501
ORF Size 3198 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005501.1, NM_005501.2, NP_005492.1
RefSeq Size 4495 bp
RefSeq ORF 3201 bp
Locus ID 3675
Cytogenetics 17q21.33
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer
MW 118.79 kDa
Gene Summary The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis. [provided by RefSeq, Oct 2015]

Other Versions

Other products for "ITGA3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
    • 50 ug

USD 425.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools