ANK1 (NM_020476) Human Tagged ORF Clone

CAT#: RC220763

Reviews ()
Write a review
  • TrueORF®

ANK1 (Myc-DDK-tagged)-Human ankyrin 1, erythrocytic (ANK1), transcript variant 1



  "NM_020476" in other vectors (3)

USD 1,980.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ANK1 (NM_020476) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ANK1
Synonyms ANK; SPH1; SPH2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC220763 representing NM_020476
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCTATTCTGTGGGCTTCCGCGAAGCCGATGCTGCTACCAGCTTTCTGAGAGCAGCAAGATCAGGTA
ACTTGGACAAAGCTTTGGATCACCTGCGGAATGGGGTAGATATTAACACCTGTAACCAGAATGGGTTGAA
TGGCTTGCATCTGGCTTCTAAGGAAGGCCATGTGAAAATGGTGGTTGAACTTCTGCACAAAGAAATCATT
CTAGAAACGACAACCAAGAAGGGGAACACGGCCCTGCACATCGCTGCTCTAGCCGGGCAGGATGAGGTGG
TCCGGGAGCTTGTCAACTATGGAGCCAACGTCAACGCCCAGTCACAGAAAGGTTTTACACCCCTGTACAT
GGCAGCACAAGAGAACCACTTGGAAGTGGTTAAGTTTTTACTGGAAAATGGAGCTAACCAGAATGTAGCC
ACAGAAGACGGCTTCACGCCTCTGGCGGTAGCCCTGCAGCAGGGCCATGAGAACGTCGTCGCGCACCTCA
TCAACTACGGCACCAAGGGGAAGGTGCGCCTCCCGGCCCTGCACATCGCGGCCCGCAACGACGACACGCG
CACGGCTGCGGTGCTGCTGCAGAACGACCCCAACCCGGACGTGCTTTCCAAGACGGGATTCACGCCCCTG
CACATTGCGGCTCACTACGAGAACCTCAACGTGGCCCAGTTGCTCCTCAACAGAGGAGCCAGCGTCAATT
TCACACCACAGAACGGCATCACGCCACTGCACATCGCCTCCCGCAGGGGCAACGTGATCATGGTGCGGCT
GCTGCTGGATCGGGGAGCCCAGATAGAAACCAAGACCAAGGACGAATTGACACCTCTCCACTGTGCAGCT
CGAAATGGGCACGTGCGAATCTCAGAGATCCTGCTGGACCACGGGGCACCAATCCAAGCCAAAACCAAGA
ACGGCCTGTCCCCAATTCACATGGCGGCTCAGGGAGACCACCTCGACTGTGTCCGGCTCCTGTTGCAATA
CGACGCAGAGATAGACGACATCACCCTGGACCACCTGACCCCACTCCACGTGGCTGCCCACTGTGGACAC
CACAGGGTGGCTAAGGTCCTTCTGGATAAAGGGGCCAAACCCAACTCCAGAGCCCTGAATGGCTTTACCC
CCTTACACATCGCCTGCAAAAAGAACCACGTCCGTGTCATGGAGCTGCTGCTGAAGACGGGAGCCTCGAT
CGACGCGGTCACCGAGTCTGGCCTGACACCTCTCCACGTGGCCTCCTTCATGGGGCACCTTCCCATCGTG
AAGAACCTCCTGCAGCGGGGGGCGTCGCCCAACGTCTCCAACGTGAAAGTGGAGACCCCGCTACACATGG
CAGCCAGAGCCGGGCACACGGAAGTGGCCAAATATTTACTCCAGAACAAAGCCAAAGTCAATGCCAAGGC
CAAGGATGACCAGACCCCACTTCACTGTGCAGCTCGCATCGGCCACACAAACATGGTGAAGCTCCTGCTG
GAAAATAACGCCAACCCCAACCTGGCCACCACCGCCGGGCACACCCCCCTGCACATTGCAGCCCGTGAGG
GCCATGTGGAAACAGTCCTGGCCCTTCTGGAAAAGGAAGCATCCCAGGCCTGCATGACCAAGAAAGGATT
TACCCCTCTGCACGTGGCGGCCAAGTACGGGAAGGTGCGGGTGGCAGAGCTGCTGCTGGAGCGGGACGCA
CACCCGAATGCTGCCGGAAAAAATGGCCTGACCCCCCTGCACGTGGCCGTCCATCACAACAACCTGGACA
TCGTCAAGCTGCTGCTTCCCCGGGGCGGCTCCCCGCACAGCCCTGCCTGGAATGGCTACACCCCTTTGCA
CATCGCTGCCAAGCAGAACCAGGTGGAGGTGGCCCGTAGTCTGCTGCAGTATGGGGGCTCAGCAAACGCC
GAGTCGGTGCAAGGTGTGACGCCCCTTCACCTGGCCGCCCAGGAGGGCCACGCAGAGATGGTGGCTCTGC
TGCTCTCGAAACAAGCCAATGGCAACCTGGGGAACAAGAGCGGACTCACTCCCCTCCATCTGGTAGCACA
AGAAGGCCACGTTCCAGTGGCAGATGTGCTGATCAAACACGGCGTCATGGTGGACGCCACCACCCGGATG
GGCTACACTCCCCTCCATGTGGCCAGTCACTATGGAAACATCAAGCTGGTGAAGTTTCTGCTGCAGCACC
AGGCAGATGTCAATGCCAAGACCAAGCTAGGATACAGCCCCCTGCACCAGGCAGCCCAGCAGGGACACAC
AGACATCGTGACTCTGCTTCTGAAAAACGGTGCTTCCCCAAACGAGGTCAGCTCGGATGGAACCACACCT
CTGGCCATAGCCAAGCGCTTGGGCTACATTTCTGTCACCGACGTGCTCAAGGTCGTCACGGATGAAACCA
GTTTCGTGTTAGTCAGTGATAAGCATCGAATGAGTTTCCCTGAGACAGTTGATGAGATCCTGGATGTCTC
GGAAGATGAAGGGGAAGAACTCATCAGCTTCAAGGCTGAGAGGCGGGATTCCAGGGATGTTGATGAAGAG
AAGGAGCTGCTGGATTTTGTGCCGAAGCTAGACCAAGTGGTGGAATCTCCAGCCATCCCCAGGATTCCCT
GTGCCATGCCTGAGACAGTGGTGATCAGGTCAGAAGAGCAGGAGCAGGCATCTAAAGAGTATGATGAGGA
CTCCCTCATCCCCAGCAGCCCGGCCACCGAGACCTCAGACAACATCAGCCCGGTGGCCAGCCCGGTGCAT
ACAGGGTTTCTGGTGAGCTTCATGGTTGACGCCCGGGGTGGTTCCATGAGAGGAAGTCGCCACAACGGCC
TGCGAGTGGTGATCCCGCCACGGACGTGCGCAGCGCCCACCCGCATCACCTGCCGCCTGGTCAAGCCCCA
GAAGCTCAGCACGCCGCCCCCACTGGCCGAGGAGGAGGGCCTGGCCAGCAGGATCATAGCACTGGGGCCC
ACGGGGGCACAGTTCCTGAGCCCTGTAATCGTGGAGATCCCGCACTTTGCCTCCCATGGCCGTGGAGACC
GCGAGCTCGTGGTTCTGAGGAGCGAAAACGGCTCCGTGTGGAAGGAGCACAGGAGCCGCTATGGAGAGAG
CTACCTGGATCAGATCCTCAACGGGATGGACGAAGAGCTGGGGAGCCTGGAGGAGCTAGAGAAGAAGAGG
GTGTGCCGAATCATCACCACCGACTTCCCGCTGTACTTCGTGATCATGTCACGGCTCTGCCAGGACTACG
ACACCATCGGTCCCGAAGGGGGCTCCCTGAAGAGCAAGCTGGTGCCCCTGGTACAGGCAACGTTCCCGGA
GAATGCCGTCACCAAGAGAGTGAAGCTGGCTCTGCAGGCCCAGCCTGTCCCGGATGAGCTTGTCACTAAG
CTCCTGGGCAACCAGGCCACATTCAGCCCCATTGTCACCGTGGAGCCCCGGCGCCGGAAGTTCCACCGCC
CCATTGGGCTTCGGATCCCACTACCTCCTTCCTGGACCGACAACCCGAGGGACAGCGGGGAGGGAGACAC
CACCAGCCTGCGCCTGCTTTGCAGCGTCATTGGAGGAACAGACCAAGCCCAGTGGGAAGACATAACAGGA
ACCACCAAACTTGTATATGCCAACGAGTGCGCCAACTTCACCACCAATGTCTCTGCCAGGTTTTGGCTGT
CGGACTGTCCTCGGACTGCTGAGGCTGTGAACTTTGCCACCCTGCTGTACAAAGAGCTCACTGCAGTGCC
CTACATGGCCAAATTCGTCATCTTTGCCAAGATGAATGACCCCCGAGAGGGGCGCCTGCGCTGCTACTGC
ATGACAGATGATAAAGTGGACAAGACCCTGGAGCAGCATGAGAACTTCGTGGAGGTGGCCCGGAGCAGGG
ACATAGAGGTGTTGGAAGGAATGTCCCTGTTTGCAGAACTCTCTGGGAACCTGGTGCCTGTGAAGAAAGC
TGCCCAGCAGCGGAGCTTCCACTTCCAGTCATTTCGGGAGAACCGTCTGGCCATGCCTGTAAAGGTGAGG
GACAGCAGTCGAGAGCCGGGAGGGTCCCTGTCGTTTCTGCGCAAGGCGATGAAGTACGAGGACACCCAGC
ACATTCTCTGCCACCTGAACATCACCATGCCCCCCTGCGCCAAGGGAAGTGGAGCCGAAGATAGGAGAAG
GACCCCGACGCCCCTGGCCCTGCGATACAGCATTCTCAGTGAGTCCACACCAGGTTCTCTCAGTGGGACA
GAGCAGGCAGAGATGAAGATGGCTGTTATCTCAGAGCACCTCGGTCTCAGCTGGGCAGAGTTGGCCCGGG
AGCTGCAGTTCAGTGTGGAAGACATCAACAGGATCCGAGTGGAAAATCCCAACTCCCTGTTGGAGCAGAG
TGTGGCCTTGCTGAACCTCTGGGTCATCCGTGAAGGCCAAAACGCAAACATGGAGAATCTGTACACAGCC
CTGCAGAGCATTGACCGTGGCGAGATCGTGAACATGCTGGAGGGTTCCGGCCGACAGAGCCGCAACTTGA
AGCCAGACAGGCGGCACACCGACCGCGACTACTCGCTGTCACCCTCCCAGATGAATGGTTACTCCTCACT
GCAGGACGAGCTGCTGTCCCCTGCCTCCCTGGGCTGTGCACTTTCCTCTCCGCTACGTGCAGACCAGTAC
TGGAATGAGGTGGCCGTCCTAGACGCCATCCCCTTGGCGGCCACGGAGCATGACACCATGCTGGAGATGT
CTGACATGCAGGTGTGGTCTGCGGGCCTCACGCCTTCTCTGGTCACTGCTGAGGACTCCTCTCTGGAGTG
TAGCAAGGCTGAGGACTCTGATGCCACAGGTCACGAGTGGAAGTTGGAGGGGGCACTCTCAGAGGAACCG
CGGGGCCCCGAGTTGGGCTCTCTGGAACTTGTGGAGGACGACACAGTGGATTCAGATGCCACAAATGGCC
TTATCGATTTGCTTGAACAGGAGGAAGGTCAGAGGTCAGAAGAGAAGCTGCCAGGTTCTAAGAGGCAGGA
TGACGCGACAGGTGCAGGGCAGGACTCAGAGAATGAAGTGTCTCTTGTTTCAGGCCATCAGAGGGGGCAA
GCCCGAATCACACATTCCCCCACCGTGAGTCAGGTGACGGAGAGGAGTCAGGACAGACTGCAGGACTGGG
ATGCAGACGGCTCGATTGTCTCATACCTGCAAGATGCTGCACAAGGTTCCTGGCAAGAGGAGGTCACGCA
AGGTCCACACTCATTCCAGGGAACAAGTACCATGACTGAAGGGCTAGAGCCCGGTGGATCTCAGGAGTAC
GAGAAGGTCCTGGTGTCTGTAAGTGAGCACACGTGGACAGAACAGCCCGAGGCTGAGAGCTCCCAGGCCG
ACAGGGACCGGAGGCAGCAAGGCCAAGAAGAGCAGGTGCAGGAGGCCAAGAACACCTTCACCCAAGTGGT
GCAGGGGAATGAGTTTCAGAATATTCCAGGGGAGCAGGTGACAGAGGAGCAATTCACGGATGAGCAGGGC
AACATTGTCACCAAGAAGATCATTCGCAAGGTGGTTCGACAGATAGACTTGTCCAGCGCCGATGCCGCCC
AGGAGCACGAGGAGGTGACTGTAGAGGGGCCCCTGGAGGATCCCAGTGAGCTGGAGGTCGATATTGATTA
CTTTATGAAACACTCCAAGGATCACACCTCGACACCCAACCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220763 representing NM_020476
Red=Cloning site Green=Tags(s)

MPYSVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEII
LETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVA
TEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPL
HIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAA
RNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGH
HRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIV
KNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLL
ENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA
HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANA
ESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRM
GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP
LAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEE
KELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVH
TGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLSTPPPLAEEEGLASRIIALGP
TGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHRSRYGESYLDQILNGMDEELGSLEELEKKR
VCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTK
LLGNQATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITG
TTKLVYANECANFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYC
MTDDKVDKTLEQHENFVEVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAMPVKVR
DSSREPGGSLSFLRKAMKYEDTQHILCHLNITMPPCAKGSGAEDRRRTPTPLALRYSILSESTPGSLSGT
EQAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENPNSLLEQSVALLNLWVIREGQNANMENLYTA
LQSIDRGEIVNMLEGSGRQSRNLKPDRRHTDRDYSLSPSQMNGYSSLQDELLSPASLGCALSSPLRADQY
WNEVAVLDAIPLAATEHDTMLEMSDMQVWSAGLTPSLVTAEDSSLECSKAEDSDATGHEWKLEGALSEEP
RGPELGSLELVEDDTVDSDATNGLIDLLEQEEGQRSEEKLPGSKRQDDATGAGQDSENEVSLVSGHQRGQ
ARITHSPTVSQVTERSQDRLQDWDADGSIVSYLQDAAQGSWQEEVTQGPHSFQGTSTMTEGLEPGGSQEY
EKVLVSVSEHTWTEQPEAESSQADRDRRQQGQEEQVQEAKNTFTQVVQGNEFQNIPGEQVTEEQFTDEQG
NIVTKKIIRKVVRQIDLSSADAAQEHEEVTVEGPLEDPSELEVDIDYFMKHSKDHTSTPNP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020476
ORF Size 5643 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020476.1, NM_020476.2, NP_065209.2
RefSeq Size 8240 bp
RefSeq ORF 5646 bp
Locus ID 286
Cytogenetics 8p11.21
Protein Families Transmembrane
MW 206.1 kDa
Gene Summary Ankyrins are a family of proteins that link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and the maintenance of specialized membrane domains. Multiple isoforms of ankyrin with different affinities for various target proteins are expressed in a tissue-specific, developmentally regulated manner. Most ankyrins are typically composed of three structural domains: an amino-terminal domain containing multiple ankyrin repeats; a central region with a highly conserved spectrin binding domain; and a carboxy-terminal regulatory domain which is the least conserved and subject to variation. Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and muscles. Mutations in erythrocytic ankyrin 1 have been associated in approximately half of all patients with hereditary spherocytosis. Complex patterns of alternative splicing in the regulatory domain, giving rise to different isoforms of ankyrin 1 have been described. Truncated muscle-specific isoforms of ankyrin 1 resulting from usage of an alternate promoter have also been identified. [provided by RefSeq, Dec 2008]

Citations (1)

Other Versions

Other products for "ANK1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
    • 100 ul

USD 428.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools