GATA6 (NM_005257) Human Tagged ORF Clone

CAT#: RC220721

GATA6 (Myc-DDK-tagged)-Human GATA binding protein 6 (GATA6)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 752.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GATA6 (NM_005257) Human Tagged ORF Clone
Symbol GATA6
Synonyms GATA-binding protein 6; transcription factor GATA-6; GATA binding protein 6
Vector pCMV6-Entry
Sequence Data
>RC220721 representing NM_005257
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTTGACTGACGGCGGCTGGTGCTTGCCGAAGCGCTTCGGGGCCGCGGGTGCGGACGCCAGCGACT
CCAGAGCCTTTCCAGCGCGGGAGCCCTCCACGCCGCCTTCCCCCATCTCTTCCTCGTCCTCCTCCTGCTC
CCGGGGCGGAGAGCGGGGCCCCGGCGGCGCCAGCAACTGCGGGACGCCTCAGCTCGACACGGAGGCGGCG
GCCGGACCCCCGGCCCGCTCGCTGCTGCTCAGTTCCTACGCTTCGCATCCCTTCGGGGCTCCCCACGGAC
CTTCGGCGCCTGGGGTCGCGGGCCCCGGGGGCAACCTGTCGAGCTGGGAGGACTTGCTGCTGTTCACTGA
CCTCGACCAAGCCGCGACCGCCAGCAAGCTGCTGTGGTCCAGCCGCGGCGCCAAGCTGAGCCCCTTCGCA
CCCGAGCAGCCGGAGGAGATGTACCAGACCCTCGCCGCTCTCTCCAGCCAGGGTCCGGCCGCCTACGACG
GCGCGCCCGGCGGCTTCGTGCACTCTGCGGCCGCGGCGGCAGCAGCCGCGGCGGCGGCCAGCTCCCCGGT
CTACGTGCCCACCACCCGCGTGGGTTCCATGCTGCCCGGCCTACCGTACCACCTGCAGGGGTCGGGCAGT
GGGCCAGCCAACCACGCGGGCGGCGCGGGCGCGCACCCCGGCTGGCCTCAGGCCTCGGCCGACAGCCCTC
CATACGGCAGCGGAGGCGGCGCGGCTGGCGGCGGGGCCGCGGGGCCTGGCGGCGCTGGCTCAGCCGCGGC
GCACGTCTCGGCGCGCTTCCCCTACTCTCCCAGCCCGCCCATGGCCAACGGCGCCGCGCGGGAGCCGGGA
GGCTACGCGGCGGCGGGCAGTGGGGGCGCGGGAGGCGTGAGCGGCGGCGGCAGTAGCCTGGCGGCCATGG
GCGGCCGCGAGCCCCAGTACAGCTCGCTGTCGGCCGCGCGGCCGCTGAACGGGACGTACCACCACCACCA
CCACCACCACCACCACCATCCGAGCCCCTACTCGCCCTACGTGGGGGCGCCACTGACGCCTGCCTGGCCC
GCCGGACCCTTCGAGACCCCGGTGCTGCACAGCCTGCAGAGCCGCGCCGGAGCCCCGCTCCCGGTGCCCC
GGGGTCCCAGTGCAGACCTGCTGGAGGACCTGTCCGAGAGCCGCGAGTGCGTGAACTGCGGCTCCATCCA
GACGCCGCTGTGGCGGCGGGACGGCACCGGCCACTACCTGTGCAACGCCTGCGGGCTCTACAGCAAGATG
AACGGCCTCAGCCGGCCCCTCATCAAGCCGCAGAAGCGCGTGCCTTCATCACGGCGGCTTGGATTGTCCT
GTGCCAACTGTCACACCACAACTACCACCTTATGGCGCAGAAACGCCGAGGGTGAACCCGTGTGCAATGC
TTGTGGACTCTACATGAAACTCCATGGGGTGCCCAGACCACTTGCTATGAAAAAAGAGGGAATTCAAACC
AGGAAACGAAAACCTAAGAACATAAATAAATCAAAGACTTGCTCTGGTAATAGCAATAATTCCATTCCCA
TGACTCCAACTTCCACCTCTTCTAACTCAGATGATTGCAGCAAAAATACTTCCCCCACAACACAACCTAC
AGCCTCAGGGGCGGGTGCCCCGGTGATGACTGGTGCGGGAGAGAGCACCAATCCCGAGAACAGCGAGCTC
AAGTATTCGGGTCAAGATGGGCTCTACATAGGCGTCAGTCTCGCCTCGCCGGCCGAAGTCACGTCCTCCG
TGCGACCGGATTCCTGGTGCGCCCTGGCCCTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220721 representing NM_005257
Red=Cloning site Green=Tags(s)

MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNCGTPQLDTEAA
AGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFA
PEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPGLPYHLQGSGS
GPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPG
GYAAAGSGGAGGVSGGGSSLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWP
AGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT
RKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSEL
KYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005257
ORF Size 1785 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005257.3, NM_005257.4, NM_005257.5, NP_005248
RefSeq Size 3494
RefSeq ORF 1788
Locus ID 2627
Cytogenetics 18q11.2
Domains GATA, GATA-N
Protein Families ES Cell Differentiation/IPS, Embryonic stem cells, Transcription Factors
MW 59.9 kDa
Gene Summary This gene is a member of a small family of zinc finger transcription factors that play an important role in the regulation of cellular differentiation and organogenesis during vertebrate development. This gene is expressed during early embryogenesis and localizes to endo- and mesodermally derived cells during later embryogenesis and thereby plays an important role in gut, lung, and heart development. Mutations in this gene are associated with several congenital defects. [provided by RefSeq, Mar 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)