IDE (NM_004969) Human Tagged ORF Clone

CAT#: RC220700

Reviews ()
Write a review

IDE (Myc-DDK-tagged)-Human insulin-degrading enzyme (IDE), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 680.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IDE
Synonyms INSULYSIN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220700 representing NM_004969
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGTACCGGCTAGCGTGGCTTCTGCACCCCGCACTGCCCAGCACCTTCCGCTCAGTCCTCGGCGCCC
GCCTGCCGCCTCCGGAGCGCCTGTGTGGTTTCCAAAAAAAGACTTACAGCAAAATGAATAATCCAGCCAT
CAAGAGAATAGGAAATCACATTACCAAGTCTCCTGAAGACAAGCGAGAATATCGAGGGCTAGAGCTGGCC
AATGGTATCAAAGTACTTCTTATGAGTGATCCCACCACGGATAAGTCATCAGCAGCACTTGATGTGCACA
TAGGTTCATTGTCGGATCCTCCAAATATTGCTGGCTTAAGTCATTTTTGTGAACATATGCTTTTTTTGGG
AACAAAGAAATACCCTAAAGAAAATGAATACAGCCAGTTTCTCAGTGAGCATGCAGGAAGTTCAAATGCC
TTTACTAGTGGAGAGCATACCAATTACTATTTTGATGTTTCTCATGAACACCTAGAAGGTGCCCTAGACA
GGTTTGCACAGTTTTTTCTGTGCCCCTTGTTCGATGAAAGTTGCAAAGACAGAGAGGTGAATGCAGTTGA
TTCAGAACATGAGAAGAATGTGATGAATGATGCCTGGAGACTCTTTCAATTGGAAAAAGCTACAGGGAAT
CCTAAACACCCCTTCAGTAAATTTGGGACAGGTAACAAATATACTCTGGAGACTAGACCAAACCAAGAAG
GCATTGATGTAAGACAAGAGCTACTGAAATTCCATTCTGCTTACTATTCATCCAACTTAATGGCTGTTTG
TGTTTTAGGTCGAGAATCTTTAGATGACTTGACTAATCTGGTGGTAAAGTTATTTTCTGAAGTAGAGAAC
AAAAATGTTCCATTGCCAGAATTTCCTGAACACCCTTTCCAAGAAGAACATCTTAAACAACTTTACAAAA
TAGTACCCATTAAAGATATTAGGAATCTCTATGTGACATTTCCCATACCTGACCTTCAGAAATACTACAA
ATCAAATCCTGGTCATTATCTTGGTCATCTCATTGGGCATGAAGGTCCTGGAAGTCTGTTATCAGAACTT
AAGTCAAAGGGCTGGGTTAATACTCTTGTTGGTGGGCAGAAGGAAGGAGCCCGAGGTTTTATGTTTTTTA
TCATTAATGTGGACTTGACCGAGGAAGGATTATTACATGTTGAAGATATAATTTTGCACATGTTTCAATA
CATTCAGAAGTTACGTGCAGAAGGACCTCAAGAATGGGTTTTCCAAGAGTGCAAGGACTTGAATGCTGTT
GCTTTTAGGTTTAAAGACAAAGAGAGGCCACGGGGCTATACATCTAAGATTGCAGGAATATTGCATTATT
ATCCCCTAGAAGAGGTGCTCACAGCGGAATATTTACTGGAAGAATTTAGACCTGACTTAATAGAGATGGT
TCTCGATAAACTCAGACCAGAAAATGTCCGGGTTGCCATAGTTTCTAAATCTTTTGAAGGAAAAACTGAT
CGCACAGAAGAGTGGTATGGAACCCAGTACAAACAAGAAGCTATACCGGATGAAGTCATCAAGAAATGGC
AAAATGCTGACCTGAATGGGAAATTTAAACTTCCTACAAAGAATGAATTTATTCCTACGAATTTTGAGAT
TTTACCGTTAGAAAAAGAGGCGACACCATACCCTGCTCTTATTAAGGATACAGTCATGAGCAAACTTTGG
TTCAAACAAGATGATAAGAAAAAAAAGCCGAAGGCTTGTCTCAACTTTGAATTTTTCAGCCCATTTGCTT
ATGTGGACCCCTTGCACTGTAACATGGCCTATTTGTACCTTGAGCTCCTCAAAGACTCACTCAACGAGTA
TGCATATGCAGCAGAGCTAGCAGGCTTGAGCTATGATCTCCAAAATACCATCTATGGGATGTATCTTTCA
GTGAAAGGTTACAATGACAAGCAGCCAATTTTACTAAAGAAGATTATTGAGAAAATGGCTACCTTTGAGA
TTGATGAAAAAAGATTTGAAATTATCAAAGAAGCATATATGCGATCTCTTAACAATTTCCGGGCTGAACA
GCCTCACCAGCATGCCATGTACTACCTCCGCTTGCTGATGACTGAAGTGGCCTGGACTAAAGATGAGTTA
AAAGAAGCTCTGGATGATGTAACCCTTCCTCGCCTTAAGGCCTTCATACCTCAGCTCCTGTCACGGCTGC
ACATTGAAGCCCTTCTCCATGGAAACATAACAAAGCAGGCTGCATTAGGAATTATGCAGATGGTTGAAGA
CACCCTCATTGAACATGCTCATACCAAACCTCTCCTTCCAAGTCAGCTGGTTCGGTATAGAGAAGTTCAG
CTCCCTGACAGAGGATGGTTTGTTTATCAGCAGAGAAATGAAGTTCACAATAACTGTGGCATCGAGATAT
ACTACCAAACAGACATGCAAAGCACCTCAGAGAATATGTTTCTGGAGCTCTTCTGTCAGATTATCTCGGA
ACCTTGCTTCAACACCCTGCGCACCAAGGAGCAGTTGGGCTATATCGTCTTCAGCGGGCCACGTCGAGCT
AATGGCATACAGAGCTTGAGATTCATCATCCAGTCAGAAAAGCCACCTCACTACCTAGAAAGCAGAGTGG
AAGCTTTCTTAATTACCATGGAAAAGTCCATAGAGGACATGACAGAAGAGGCCTTCCAAAAACACATTCA
GGCATTAGCAATTCGTCGACTAGACAAACCAAAGAAGCTATCTGCTGAGTGTGCTAAATACTGGGGAGAA
ATCATCTCCCAGCAATATAATTTTGACAGAGATAACACTGAGGTTGCATATTTAAAGACACTTACCAAGG
AAGATATCATCAAATTCTACAAGGAAATGTTGGCAGTAGATGCTCCAAGGAGACATAAGGTATCCGTCCA
TGTTCTTGCCAGGGAAATGGATTCTTGTCCTGTTGTTGGAGAGTTCCCATGTCAAAATGACATAAATTTG
TCACAAGCACCAGCCTTGCCACAACCTGAAGTGATTCAGAACATGACCGAATTCAAGCGTGGTCTGCCAC
TGTTTCCCCTTGTGAAACCACATATTAACTTCATGGCTGCAAAACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220700 representing NM_004969
Red=Cloning site Green=Tags(s)

MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELA
NGIKVLLMSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNA
FTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGN
PKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVEN
KNVPLPEFPEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSEL
KSKGWVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV
AFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEGKTD
RTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPTKNEFIPTNFEILPLEKEATPYPALIKDTVMSKLW
FKQDDKKKKPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYGMYLS
VKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDEL
KEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQ
LPDRGWFVYQQRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA
NGIQSLRFIIQSEKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGE
IISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINL
SQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004969
ORF Size 3057 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004969.1, NP_004960.1
RefSeq Size 3279 bp
RefSeq ORF 3060 bp
Locus ID 3416
UniProt ID P14735
Cytogenetics 10q23.33
Domains Peptidase_M16, Peptidase_M16_C
Protein Families Druggable Genome, Protease
Protein Pathways Alzheimer's disease
MW 117.8 kDa
Gene Summary This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described but have not been experimentally verified.[provided by RefSeq, Sep 2009]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.