VAV3 (NM_006113) Human Tagged ORF Clone

CAT#: RC220550

VAV3 (Myc-DDK-tagged)-Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 1

Change vector?

USD 1,298


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name VAV3 (NM_006113) Human Tagged ORF Clone
Symbol VAV3
Synonyms FLJ40431
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC220550 representing NM_006113
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCGTGGAAGCAGTGCGCGCAGTGGCTCATCCATTGCAAGGTGCTGCCCACCAACCACCGGGTGA
CCTGGGACTCGGCTCAGGTGTTCGACCTTGCGCAGACCCTCCGCGATGGAGTCCTGCTCTGCCAGCTGCT
TAACAACCTCCGGGCGCACTCCATCAACCTGAAGGAGATCAACCTGAGGCCGCAGATGTCCCAGTTTCTC
TGTTTGAAGAACATAAGGACATTTCTCACGGCCTGTTGTGAGACGTTTGGAATGAGGAAAAGTGAACTTT
TCGAGGCATTTGACTTGTTTGATGTTCGTGACTTTGGAAAGGTTATAGAAACATTATCACGACTTTCTCG
AACACCTATAGCATTGGCCACAGGAATCAGGCCCTTCCCAACAGAAGAAAGCATTAATGATGAAGACATC
TACAAAGGCCTTCCTGATTTAATAGATGAAACCCTTGTGGAAGATGAAGAAGATCTCTATGACTGTGTTT
ATGGGGAAGATGAAGGTGGAGAAGTCTATGAGGACTTAATGAAGGCAGAGGAAGCACATCAGCCCAAATG
TCCAGAAAATGATATACGAAGTTGTTGTCTAGCAGAAATTAAGCAGACAGAAGAAAAATATACAGAAACT
TTGGAGTCAATAGAAAAGTATTTCATGGCACCACTAAAAAGATTTCTGACAGCAGCAGAATTTGATTCAG
TATTCATCAACATTCCTGAACTTGTAAAACTTCATCGGAACCTAATGCAAGAGATTCATGATTCCATTGT
AAATAAAAATGACCAGAACTTGTACCAAGTTTTTATTAACTACAAGGAAAGATTGGTTATTTACGGGCAG
TACTGCAGTGGAGTGGAGTCAGCCATCTCTAGTTTAGACTACATTTCTAAGACAAAAGAAGATGTCAAAC
TGAAATTAGAGGAATGTTCCAAAAGAGCAAATAATGGGAAATTTACTCTTCGAGACTTGCTTGTGGTTCC
TATGCAACGTGTTTTAAAGTACCACCTTCTCCTCCAGGAACTGGTCAAACATACCACTGATCCGACTGAG
AAGGCAAATCTGAAACTGGCTCTTGATGCCATGAAGGACTTGGCACAATATGTGAATGAAGTGAAAAGAG
ATAATGAGACCCTTCGTGAAATTAAACAGTTTCAGCTATCTATAGAGAATTTGAACCAACCAGTTTTGCT
TTTTGGACGACCTCAGGGAGATGGTGAAATTCGAATAACCACTCTAGACAAGCATACCAAACAAGAAAGG
CATATCTTCTTATTTGATTTGGCAGTGATCGTATGTAAGAGAAAAGGTGATAACTATGAAATGAAGGAAA
TAATAGATCTTCAGCAGTACAAGATAGCCAATAATCCTACAACCGATAAAGAAAACAAAAAGTGGTCTTA
TGGCTTCTACCTCATCCATACCCAAGGACAAAATGGGTTAGAATTTTATTGCAAAACAAAAGATTTAAAG
AAGAAATGGCTAGAACAGTTTGAAATGGCTTTGTCTAACATAAGACCAGACTATGCAGACTCCAATTTCC
ACGACTTCAAGATGCATACCTTCACTCGAGTCACATCCTGCAAAGTCTGCCAGATGCTCCTGAGGGGAAC
ATTTTATCAAGGCTATTTATGTTTTAAGTGTGGAGCGAGAGCACACAAAGAATGTTTGGGAAGAGTAGAC
AATTGTGGCAGAGTTAATTCTGGTGAACAAGGGACACTCAAACTACCAGAGAAACGGACCAATGGACTGC
GAAGAACTCCTAAACAGGTGGATCCAGGTTTACCAAAGATGCAGGTCATTAGGAACTATTCTGGAACACC
ACCCCCAGCTCTGCATGAAGGACCCTCTTTACACCTCCAGGCCGGGGATACCGTTGAACTTCTGAAAGGA
GATGCACACAGTCTGTTTTGGCAGGGCAGAAATTTAGCATCTGGAGAGGTTGGATTTTTTCCAAGTGATG
CAGTCAAGCCTTGCCCATGTGTGCCCAAACCAGTAGATTATTCTTGCCAACCCTGGTATGCTGGAGCAAT
GGAAAGATTGCAAGCAGAGACCGAACTTATTAATAGGGTAAATAGTACTTACCTTGTGAGGCACAGGACC
AAAGAGTCAGGAGAATATGCAATTAGCATTAAGTACAATAATGAAGCAAAGCACATCAAGATTTTAACAA
GAGATGGCTTTTTTCACATTGCAGAAAATAGAAAATTTAAAAGTTTAATGGAACTTGTGGAGTACTACAA
GCATCATTCTCTCAAGGAAGGGTTCAGAACCTTAGATACAACTCTGCAGTTTCCATACAAGGAGCCAGAA
CATTCAGCTGGACAGAGGGGTAATAGAGCAGGCAACAGCTTGTTAAGTCCAAAAGTGCTGGGCATTGCCA
TCGCTCGGTATGACTTCTGTGCAAGAGATATGAGAGAGTTGTCCTTGTTGAAAGGAGATGTGGTGAAGAT
TTACACAAAGATGAGTGCAAATGGCTGGTGGAGAGGAGAAGTAAATGGCAGGGTGGGCTGGTTTCCATCC
ACATATGTGGAAGAGGATGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220550 representing NM_006113
Red=Cloning site Green=Tags(s)

MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFL
CLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDI
YKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTET
LESIEKYFMAPLKRFLTAAEFDSVFINIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQ
YCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTE
KANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLK
KKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVD
NCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPSLHLQAGDTVELLKG
DAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRT
KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE
HSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006113
ORF Size 2541 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006113.1, NM_006113.2, NM_006113.3, NM_006113.4, NP_006104
RefSeq Size 4768
RefSeq ORF 2544
Locus ID 10451
Cytogenetics 1p13.3
Domains RhoGEF, SH2, SH3, CH, PH, C1
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Regulation of actin cytoskeleton
MW 97.6 kDa
Gene Summary This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.