Integrin beta 4 (ITGB4) (NM_000213) Human Tagged ORF Clone

CAT#: RC220541

Reviews ()
Write a review

ITGB4 (Myc-DDK-tagged)-Human integrin, beta 4 (ITGB4), transcript variant 1



  "NM_000213" in other vectors (3)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,531.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ITGB4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGB4
Synonyms CD104; GP150
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220541 representing NM_000213
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGGCCACGCCCCAGCCCATGGGCCAGGCTGCTCCTGGCAGCCTTGATCAGCGTCAGCCTCTCTG
GGACCTTGGCAAACCGCTGCAAGAAGGCCCCAGTGAAGAGCTGCACGGAGTGTGTCCGTGTGGATAAGGA
CTGCGCCTACTGCACAGACGAGATGTTCAGGGACCGGCGCTGCAACACCCAGGCGGAGCTGCTGGCCGCG
GGCTGCCAGCGGGAGAGCATCGTGGTCATGGAGAGCAGCTTCCAAATCACAGAGGAGACCCAGATTGACA
CCACCCTGCGGCGCAGCCAGATGTCCCCCCAAGGCCTGCGGGTCCGTCTGCGGCCCGGTGAGGAGCGGCA
TTTTGAGCTGGAGGTGTTTGAGCCACTGGAGAGCCCCGTGGACCTGTACATCCTCATGGACTTCTCCAAC
TCCATGTCCGATGATCTGGACAACCTCAAGAAGATGGGGCAGAACCTGGCTCGGGTCCTGAGCCAGCTCA
CCAGCGACTACACTATTGGATTTGGCAAGTTTGTGGACAAAGTCAGCGTCCCGCAGACGGACATGAGGCC
TGAGAAGCTGAAGGAGCCCTGGCCCAACAGTGACCCCCCCTTCTCCTTCAAGAACGTCATCAGCCTGACA
GAAGATGTGGATGAGTTCCGGAATAAACTGCAGGGAGAGCGGATCTCAGGCAACCTGGATGCTCCTGAGG
GCGGCTTCGATGCCATCCTGCAGACAGCTGTGTGCACGAGGGACATTGGCTGGCGCCCGGACAGCACCCA
CCTGCTGGTCTTCTCCACCGAGTCAGCCTTCCACTATGAGGCTGATGGCGCCAACGTGCTGGCTGGCATC
ATGAGCCGCAACGATGAACGGTGCCACCTGGACACCACGGGCACCTACACCCAGTACAGGACACAGGACT
ACCCGTCGGTGCCCACCCTGGTGCGCCTGCTCGCCAAGCACAACATCATCCCCATCTTTGCTGTCACCAA
CTACTCCTATAGCTACTACGAGAAGCTTCACACCTATTTCCCTGTCTCCTCACTGGGGGTGCTGCAGGAG
GACTCGTCCAACATCGTGGAGCTGCTGGAGGAGGCCTTCAATCGGATCCGCTCCAACCTGGACATCCGGG
CCCTAGACAGCCCCCGAGGCCTTCGGACAGAGGTCACCTCCAAGATGTTCCAGAAGACGAGGACTGGGTC
CTTTCACATCCGGCGGGGGGAAGTGGGTATATACCAGGTGCAGCTGCGGGCCCTTGAGCACGTGGATGGG
ACGCACGTGTGCCAGCTGCCGGAGGACCAGAAGGGCAACATCCATCTGAAACCTTCCTTCTCCGACGGCC
TCAAGATGGACGCGGGCATCATCTGTGATGTGTGCACCTGCGAGCTGCAAAAAGAGGTGCGGTCAGCTCG
CTGCAGCTTCAACGGAGACTTCGTGTGCGGACAGTGTGTGTGCAGCGAGGGCTGGAGTGGCCAGACCTGC
AACTGCTCCACCGGCTCTCTGAGTGACATTCAGCCCTGCCTGCGGGAGGGCGAGGACAAGCCGTGCTCCG
GCCGTGGGGAGTGCCAGTGCGGGCACTGTGTGTGCTACGGCGAAGGCCGCTACGAGGGTCAGTTCTGCGA
GTATGACAACTTCCAGTGTCCCCGCACTTCCGGGTTCCTCTGCAATGACCGAGGACGCTGCTCCATGGGC
CAGTGTGTGTGTGAGCCTGGTTGGACAGGCCCAAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCG
ACAGCAATGGGGGCATCTGTAATGGACGTGGCCACTGTGAGTGTGGCCGCTGCCACTGCCACCAGCAGTC
GCTCTACACGGACACCATCTGCGAGATCAACTACTCGGCGATCCACCCGGGCCTCTGCGAGGACCTACGC
TCCTGCGTGCAGTGCCAGGCGTGGGGCACCGGCGAGAAGAAGGGGCGCACGTGTGAGGAATGCAACTTCA
AGGTCAAGATGGTGGACGAGCTTAAGAGAGCCGAGGAGGTGGTGGTGCGCTGCTCCTTCCGGGACGAGGA
TGACGACTGCACCTACAGCTACACCATGGAAGGTGACGGCGCCCCTGGGCCCAACAGCACTGTCCTGGTG
CACAAGAAGAAGGACTGCCCTCCGGGCTCCTTCTGGTGGCTCATCCCCCTGCTCCTCCTCCTCCTGCCGC
TCCTGGCCCTGCTACTGCTGCTATGCTGGAAGTACTGTGCCTGCTGCAAGGCCTGCCTGGCACTTCTCCC
GTGCTGCAACCGAGGTCACATGGTGGGCTTTAAGGAAGACCACTACATGCTGCGGGAGAACCTGATGGCC
TCTGACCACTTGGACACGCCCATGCTGCGCAGCGGGAACCTCAAGGGCCGTGACGTGGTCCGCTGGAAGG
TCACCAACAACATGCAGCGGCCTGGCTTTGCCACTCATGCCGCCAGCATCAACCCCACAGAGCTGGTGCC
CTACGGGCTGTCCTTGCGCCTGGCCCGCCTTTGCACCGAGAACCTGCTGAAGCCTGACACTCGGGAGTGC
GCCCAGCTGCGCCAGGAGGTGGAGGAGAACCTGAACGAGGTCTACAGGCAGATCTCCGGTGTACACAAGC
TCCAGCAGACCAAGTTCCGGCAGCAGCCCAATGCCGGGAAAAAGCAAGACCACACCATTGTGGACACAGT
GCTGATGGCGCCCCGCTCGGCCAAGCCGGCCCTGCTGAAGCTTACAGAGAAGCAGGTGGAACAGAGGGCC
TTCCACGACCTCAAGGTGGCCCCCGGCTACTACACCCTCACTGCAGACCAGGACGCCCGGGGCATGGTGG
AGTTCCAGGAGGGCGTGGAGCTGGTGGACGTACGGGTGCCCCTCTTTATCCGGCCTGAGGATGACGACGA
GAAGCAGCTGCTGGTGGAGGCCATCGACGTGCCCGCAGGCACTGCCACCCTCGGCCGCCGCCTGGTAAAC
ATCACCATCATCAAGGAGCAAGCCAGAGACGTGGTGTCCTTTGAGCAGCCTGAGTTCTCGGTCAGCCGCG
GGGACCAGGTGGCCCGCATCCCTGTCATCCGGCGTGTCCTGGACGGCGGGAAGTCCCAGGTCTCCTACCG
CACACAGGATGGCACCGCGCAGGGCAACCGGGACTACATCCCCGTGGAGGGTGAGCTGCTGTTCCAGCCT
GGGGAGGCCTGGAAAGAGCTGCAGGTGAAGCTCCTGGAGCTGCAAGAAGTTGACTCCCTCCTGCGGGGCC
GCCAGGTCCGCCGTTTCCACGTCCAGCTCAGCAACCCTAAGTTTGGGGCCCACCTGGGCCAGCCCCACTC
CACCACCATCATCATCAGGGACCCAGATGAACTGGACCGGAGCTTCACGAGTCAGATGTTGTCATCACAG
CCACCCCCTCACGGCGACCTGGGCGCCCCGCAGAACCCCAATGCTAAGGCCGCTGGGTCCAGGAAGATCC
ATTTCAACTGGCTGCCCCCTTCTGGCAAGCCAATGGGGTACAGGGTAAAGTACTGGATTCAGGGTGACTC
CGAATCCGAAGCCCACCTGCTCGACAGCAAGGTGCCCTCAGTGGAGCTCACCAACCTGTACCCGTATTGC
GACTATGAGATGAAGGTGTGCGCCTACGGGGCTCAGGGCGAGGGACCCTACAGCTCCCTGGTGTCCTGCC
GCACCCACCAGGAAGTGCCCAGCGAGCCAGGGCGTCTGGCCTTCAATGTCGTCTCCTCCACGGTGACCCA
GCTGAGCTGGGCTGAGCCGGCTGAGACCAACGGTGAGATCACAGCCTACGAGGTCTGCTATGGCCTGGTC
AACGATGACAACCGACCTATTGGGCCCATGAAGAAAGTGCTGGTTGACAACCCTAAGAACCGGATGCTGC
TTATTGAGAACCTTCGGGAGTCCCAGCCCTACCGCTACACGGTGAAGGCGCGCAACGGGGCCGGCTGGGG
GCCTGAGCGGGAGGCCATCATCAACCTGGCCACCCAGCCCAAGAGGCCCATGTCCATCCCCATCATCCCT
GACATCCCTATCGTGGACGCCCAGAGCGGGGAGGACTACGACAGCTTCCTTATGTACAGCGATGACGTTC
TACGCTCTCCATCGGGCAGCCAGAGGCCCAGCGTCTCCGATGACACTGGCTGCGGCTGGAAGTTCGAGCC
CCTGCTGGGGGAGGAGCTGGACCTGCGGCGCGTCACGTGGCGGCTGCCCCCGGAGCTCATCCCGCGCCTG
TCGGCCAGCAGCGGGCGCTCCTCCGACGCCGAGGCGCCCCACGGGCCCCCGGACGACGGCGGCGCGGGCG
GGAAGGGCGGCAGCCTGCCCCGCAGTGCGACACCCGGGCCCCCCGGAGAGCACCTGGTGAATGGCCGGAT
GGACTTTGCCTTCCCGGGCAGCACCAACTCCCTGCACAGGATGACCACGACCAGTGCTGCTGCCTATGGC
ACCCACCTGAGCCCACACGTGCCCCACCGCGTGCTAAGCACATCCTCCACCCTCACACGGGACTACAACT
CACTGACCCGCTCAGAACACTCACACTCGACCACACTGCCSAGGGACTACTCCACCCTCACCTCCGTCTC
CTCCCACGACTCTCGCCTGACTGCTGGTGTGCCCGACACGCCCACCCGCCTGGTGTTCTCTGCCCTGGGG
CCCACATCTCTCAGAGTGAGCTGGCAGGAGCCGCGGTGCGAGCGGCCGCTGCAGGGCTACAGTGTGGAGT
ACCAGCTGCTGAACGGCGGTGAGCTGCATCGGCTCAACATCCCCAACCCTGCCCAGACCTCGGTGGTGGT
GGAAGACCTCCTGCCCAACCACTCCTACGTGTTCCGCGTGCGGGCCCAGAGCCAGGAAGGCTGGGGCCGA
GAGCGTGAGGGTGTCATCACCATTGAATCCCAGGTGCACCCGCAGAGCCCACTGTGTCCCCTGCCAGGCT
CCGCCTTCACTTTGAGCACTCCCAGTGCCCCAGGCCCGCTGGTGTTCACTGCCCTGAGCCCAGACTCGCT
GCAGCTGAGCTGGGAGCGGCCACGGAGGCCCAATGGGGATATCGTCGGCTACCTGGTGACCTGTGAGATG
GCCCAAGGAGGAGGGCCAGCCACCGCATTCCGGGTGGATGGAGACAGCCCCGAGAGCCGGCTGACCGTGC
CGGGCCTCAGCGAGAACGTGCCCTACAAGTTCAAGGTGCAGGCCAGGACCACTGAGGGCTTCGGGCCAGA
GCGCGAGGGCATCATCACCATAGAGTCCCAGGATGGAGGACCCTTCCCGCAGCTGGGCAGCCGTGCCGGG
CTCTTCCAGCACCCGCTGCAAAGCGAGTACAGCAGCATCACCACCACCCACACCAGCGCCACCGAGCCCT
TCCTAGTGGATGGGCCGACCCTGGGGGCCCAGCACCTGGAGGCAGGCGGCTCCCTCACCCGGCATGTGAC
CCAGGAGTTTGTGAGCCGGACACTGACCACCAGCGGAACCCTTAGCACCCACATGGACCAACAGTTCTTC
CCAACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220541 representing NM_000213
Red=Cloning site Green=Tags(s)

MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAA
GCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFELEVFEPLESPVDLYILMDFSN
SMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNVISLT
EDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGI
MSRNDERCHLDTTGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQE
DSSNIVELLEEAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQTC
NCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNFQCPRTSGFLCNDRGRCSMG
QCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLR
SCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLV
HKKKDCPPGSFWWLIPLLLLLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMA
SDHLDTPMLRSGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLKLTEKQVEQRA
FHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVN
ITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQP
GEAWKELQVKLLELQEVDSLLRGRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQ
PPPHGDLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYC
DYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIP
DIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLGEELDLRRVTWRLPPELIPRL
SASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGEHLVNGRMDFAFPGSTNSLHRMTTTSAAAYG
THLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLXRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALG
PTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGR
EREGVITIESQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSRAG
LFQHPLQSEYSSITTTHTSATEPFLVDGPTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQQFF
PT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000213
ORF Size 5466 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000213.5
RefSeq Size 5925 bp
RefSeq ORF 5469 bp
Locus ID 3691
UniProt ID P16144
Cytogenetics 17q25.1
Domains INB, Calx-beta, PSI, FN3, EGF
Protein Families Druggable Genome
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Regulation of actin cytoskeleton
MW 202.12 kDa
Gene Summary Integrins are heterodimers comprised of alpha and beta subunits, that are noncovalently associated transmembrane glycoprotein receptors. Different combinations of alpha and beta polypeptides form complexes that vary in their ligand-binding specificities. Integrins mediate cell-matrix or cell-cell adhesion, and transduced signals that regulate gene expression and cell growth. This gene encodes the integrin beta 4 subunit, a receptor for the laminins. This subunit tends to associate with alpha 6 subunit and is likely to play a pivotal role in the biology of invasive carcinoma. Mutations in this gene are associated with epidermolysis bullosa with pyloric atresia. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.