CASK (NM_003688) Human Tagged ORF Clone

CAT#: RC220531

CASK (Myc-DDK-tagged)-Human calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,412.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CASK (NM_003688) Human Tagged ORF Clone
Symbol CASK
Synonyms CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC220531 representing NM_003688
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACGACGACGTGCTGTTCGAGGATGTGTACGAGCTGTGCGAGGTGATCGGAAAGGGTCCCTTCA
GTGTTGTACGACGATGTATCAACAGAGAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAA
GTTCACATCAAGTCCAGGGTTAAGTACAGAAGATCTAAAGCGGGAAGCCAGTATCTGTCATATGCTGAAA
CATCCACACATTGTAGAGTTATTGGAGACATATAGCTCAGATGGAATGCTTTACATGGTTTTCGAATTTA
TGGATGGAGCAGATCTGTGTTTTGAAATCGTAAAGCGAGCTGACGCTGGTTTTGTGTACAGTGAAGCTGT
AGCCAGCCATTATATGAGACAGATACTGGAAGCTCTACGCTACTGCCATGATAATAACATAATTCACAGG
GATGTGAAGCCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGAGGCTTTG
GGGTAGCTATTCAATTAGGGGAGTCTGGACTTGTAGCTGGAGGACGTGTTGGAACACCTCATTTTATGGC
ACCAGAAGTGGTCAAAAGAGAGCCTTACGGAAAGCCTGTAGACGTCTGGGGGTGCGGTGTGATCCTTTTT
ATCCTGCTCAGTGGTTGTTTGCCTTTTTACGGAACCAAGGAAAGATTGTTTGAAGGCATTATTAAAGGAA
AATATAAGATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGTCGCATGCT
GATGCTGGATCCAGCTGAAAGGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAGGAGCGGGAT
CGTTACGCCTACAAGATTCATCTTCCAGAAACAGTAGAGCAGCTGAGGAAATTCAATGCAAGGAGGAAAC
TAAAGGGTGCAGTACTAGCCGCTGTGTCAAGTCACAAATTCAACTCATTCTATGGGGATCCCCCTGAAGA
GTTACCAGATTTCTCCGAAGACCCTACCTCCTCAGGGCTTCTAGCAGCAGAAAGAGCAGTCTCACAGGTG
CTGGACAGCCTGGAAGAGATTCATGCGCTTACAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTG
TTTTCCAGGATCAGCATCTTCACACACTACTAGATCTGTATGACAAAATTAACACAAAGTCTTCACCACA
AATCAGGAATCCTCCAAGCGATGCAGTACAGAGAGCCAAAGAGGTATTGGAAGAAATTTCATGTTACCCT
GAGAATAACGACGCAAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATGGCCTTACTTCAGACTC
ACGACGTAGTGGCACATGAAGTTTACAGTGATGAAGCATTGAGGGTCACACCTCCTCCCACCTCTCCCTA
TTTAAACGGCGATTCTCCAGAAAGTGCTAACGGAGACATGGATATGGAGAATGTGACCAGAGTTCGGCTG
GTACAGTTTCAAAAGAACACAGATGAACCAATGGGAATCACTTTAAAAATGAATGAACTAAATCATTGTA
TTGTTGCAAGAATTATGCATGGGGGCATGATTCACAGGCAAGGTACACTTCATGTTGGTGATGAAATTCG
AGAAATCAATGGCATCAGTGTGGCTAACCAAACAGTGGAACAACTGCAAAAAATGCTTAGGGAAATGCGG
GGGAGTATTACCTTCAAGATTGTGCCAAGTTACCGCACTCAGTCTTCGTCCTGTGAGAGAGATTCCCCTT
CCACTTCCAGACAGTCCCCAGCTAATGGTCATAGCAGCACTAACAATTCTGTTTCGGACTTGCCATCAAC
TACCCAACCAAAAGGACGACAGATCTATGTAAGAGCACAATTTGAATATGATCCAGCCAAGGATGACCTC
ATCCCCTGTAAAGAAGCTGGCATTCGATTCAGAGTTGGTGACATCATCCAGATTATTAGTAAGGATGATC
ATAATTGGTGGCAGGGTAAACTGGAAAACTCCAAAAATGGAACTGCAGGTCTCATTCCTTCTCCTGAACT
TCAGGAATGGCGAGTAGCTTGCATTGCCATGGAGAAGACCAAACAGGAGCAGCAGGCCAGCTGTACTTGG
TTTGGCAAGAAAAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCACAATGCAGTGTTTGATCAATTAG
ATCTTGTCACATATGAAGAAGTAGTAAAACTGCCAGCATTCAAGAGGAAAACACTAGTCTTATTAGGCGC
ACATGGTGTTGGGAGAAGACACATAAAAAACACTCTCATCACAAAGCACCCAGACCGGTTTGCGTACCCT
ATTCCACATACAACCAGACCTCCAAAGAAAGACGAAGAAAATGGAAAGAATTATTACTTTGTATCTCATG
ACCAAATGATGCAAGACATCTCTAATAACGAGTACTTGGAGTACGGCAGCCACGAGGATGCGATGTATGG
GACAAAACTGGAGACCATCCGGAAGATCCACGAGCAGGGGCTGATTGCAATACTGGACGTGGAGCCTCAG
GCACTGAAGGTCCTGAGAACTGCAGAGTTTGCTCCTTTTGTTGTTTTCATTGCTGCACCAACTATTACTC
CAGGTTTAAATGAGGATGAATCTCTTCAGCGTCTGCAGAAGGAGTCTGACATCTTACAGAGAACATATGC
ACACTACTTCGATCTCACAATTATCAACAATGAAATTGATGAGACAATCAGACATCTGGAGGAAGCTGTT
GAGCTCGTGTGCACAGCCCCACAGTGGGTCCCTGTCTCCTGGGTCTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220531 representing NM_003688
Red=Cloning site Green=Tags(s)

MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLK
HPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHR
DVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILF
ILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERD
RYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQV
LDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRL
VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMR
GSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDL
IPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTW
FGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYP
IPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ
ALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAV
ELVCTAPQWVPVSWVY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003688
ORF Size 2778 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003688.1, NP_003679
RefSeq Size 3122
RefSeq ORF 2766
Locus ID 8573
Cytogenetics Xp11.4
Domains pkinase, TyrKc, SH3, PDZ, S_TKc, L27, Guanylate_kin, GuKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways Tight junction
MW 104.3 kDa
Gene Summary This gene encodes a calcium/calmodulin-dependent serine protein kinase. The encoded protein is a MAGUK (membrane-associated guanylate kinase) protein family member. These proteins are scaffold proteins and the encoded protein is located at synapses in the brain. Mutations in this gene are associated with FG syndrome 4, mental retardation and microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)