CASK (NM_003688) Human Tagged ORF Clone

CAT#: RC220531

Reviews ()
Write a review

CASK (Myc-DDK-tagged)-Human calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,157.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CASK
Synonyms CAGH39; CAMGUK; CMG; FGS4; hCASK; LIN2; MICPCH; MRXSNA; TNRC8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220531 representing NM_003688
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACGACGACGTGCTGTTCGAGGATGTGTACGAGCTGTGCGAGGTGATCGGAAAGGGTCCCTTCA
GTGTTGTACGACGATGTATCAACAGAGAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAA
GTTCACATCAAGTCCAGGGTTAAGTACAGAAGATCTAAAGCGGGAAGCCAGTATCTGTCATATGCTGAAA
CATCCACACATTGTAGAGTTATTGGAGACATATAGCTCAGATGGAATGCTTTACATGGTTTTCGAATTTA
TGGATGGAGCAGATCTGTGTTTTGAAATCGTAAAGCGAGCTGACGCTGGTTTTGTGTACAGTGAAGCTGT
AGCCAGCCATTATATGAGACAGATACTGGAAGCTCTACGCTACTGCCATGATAATAACATAATTCACAGG
GATGTGAAGCCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGAGGCTTTG
GGGTAGCTATTCAATTAGGGGAGTCTGGACTTGTAGCTGGAGGACGTGTTGGAACACCTCATTTTATGGC
ACCAGAAGTGGTCAAAAGAGAGCCTTACGGAAAGCCTGTAGACGTCTGGGGGTGCGGTGTGATCCTTTTT
ATCCTGCTCAGTGGTTGTTTGCCTTTTTACGGAACCAAGGAAAGATTGTTTGAAGGCATTATTAAAGGAA
AATATAAGATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGTCGCATGCT
GATGCTGGATCCAGCTGAAAGGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAGGAGCGGGAT
CGTTACGCCTACAAGATTCATCTTCCAGAAACAGTAGAGCAGCTGAGGAAATTCAATGCAAGGAGGAAAC
TAAAGGGTGCAGTACTAGCCGCTGTGTCAAGTCACAAATTCAACTCATTCTATGGGGATCCCCCTGAAGA
GTTACCAGATTTCTCCGAAGACCCTACCTCCTCAGGGCTTCTAGCAGCAGAAAGAGCAGTCTCACAGGTG
CTGGACAGCCTGGAAGAGATTCATGCGCTTACAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTG
TTTTCCAGGATCAGCATCTTCACACACTACTAGATCTGTATGACAAAATTAACACAAAGTCTTCACCACA
AATCAGGAATCCTCCAAGCGATGCAGTACAGAGAGCCAAAGAGGTATTGGAAGAAATTTCATGTTACCCT
GAGAATAACGACGCAAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATGGCCTTACTTCAGACTC
ACGACGTAGTGGCACATGAAGTTTACAGTGATGAAGCATTGAGGGTCACACCTCCTCCCACCTCTCCCTA
TTTAAACGGCGATTCTCCAGAAAGTGCTAACGGAGACATGGATATGGAGAATGTGACCAGAGTTCGGCTG
GTACAGTTTCAAAAGAACACAGATGAACCAATGGGAATCACTTTAAAAATGAATGAACTAAATCATTGTA
TTGTTGCAAGAATTATGCATGGGGGCATGATTCACAGGCAAGGTACACTTCATGTTGGTGATGAAATTCG
AGAAATCAATGGCATCAGTGTGGCTAACCAAACAGTGGAACAACTGCAAAAAATGCTTAGGGAAATGCGG
GGGAGTATTACCTTCAAGATTGTGCCAAGTTACCGCACTCAGTCTTCGTCCTGTGAGAGAGATTCCCCTT
CCACTTCCAGACAGTCCCCAGCTAATGGTCATAGCAGCACTAACAATTCTGTTTCGGACTTGCCATCAAC
TACCCAACCAAAAGGACGACAGATCTATGTAAGAGCACAATTTGAATATGATCCAGCCAAGGATGACCTC
ATCCCCTGTAAAGAAGCTGGCATTCGATTCAGAGTTGGTGACATCATCCAGATTATTAGTAAGGATGATC
ATAATTGGTGGCAGGGTAAACTGGAAAACTCCAAAAATGGAACTGCAGGTCTCATTCCTTCTCCTGAACT
TCAGGAATGGCGAGTAGCTTGCATTGCCATGGAGAAGACCAAACAGGAGCAGCAGGCCAGCTGTACTTGG
TTTGGCAAGAAAAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCACAATGCAGTGTTTGATCAATTAG
ATCTTGTCACATATGAAGAAGTAGTAAAACTGCCAGCATTCAAGAGGAAAACACTAGTCTTATTAGGCGC
ACATGGTGTTGGGAGAAGACACATAAAAAACACTCTCATCACAAAGCACCCAGACCGGTTTGCGTACCCT
ATTCCACATACAACCAGACCTCCAAAGAAAGACGAAGAAAATGGAAAGAATTATTACTTTGTATCTCATG
ACCAAATGATGCAAGACATCTCTAATAACGAGTACTTGGAGTACGGCAGCCACGAGGATGCGATGTATGG
GACAAAACTGGAGACCATCCGGAAGATCCACGAGCAGGGGCTGATTGCAATACTGGACGTGGAGCCTCAG
GCACTGAAGGTCCTGAGAACTGCAGAGTTTGCTCCTTTTGTTGTTTTCATTGCTGCACCAACTATTACTC
CAGGTTTAAATGAGGATGAATCTCTTCAGCGTCTGCAGAAGGAGTCTGACATCTTACAGAGAACATATGC
ACACTACTTCGATCTCACAATTATCAACAATGAAATTGATGAGACAATCAGACATCTGGAGGAAGCTGTT
GAGCTCGTGTGCACAGCCCCACAGTGGGTCCCTGTCTCCTGGGTCTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220531 representing NM_003688
Red=Cloning site Green=Tags(s)

MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLK
HPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHR
DVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILF
ILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERD
RYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQV
LDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRL
VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMR
GSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDL
IPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTW
FGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYP
IPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ
ALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAV
ELVCTAPQWVPVSWVY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003688
ORF Size 2778 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 3122 bp
RefSeq ORF 2766 bp
Locus ID 8573
UniProt ID O14936
Cytogenetics Xp11.4
Domains pkinase, TyrKc, SH3, PDZ, S_TKc, L27, Guanylate_kin, GuKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Tight junction
MW 104.3 kDa
Gene Summary This gene encodes a calcium/calmodulin-dependent serine protein kinase. The encoded protein is a MAGUK (membrane-associated guanylate kinase) protein family member. These proteins are scaffold proteins and the encoded protein is located at synapses in the brain. Mutations in this gene are associated with FG syndrome 4, intellectual disability and microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked intellectual disability. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017]
Other products for "CASK"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.