HNRPM (HNRNPM) (NM_031203) Human Tagged ORF Clone

CAT#: RC220513

Reviews ()
Write a review

HNRNPM (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein M (HNRNPM), transcript variant 2



  "NM_031203" in other vectors (6)

Reconstitution Protocol

USD 633.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "HNRNPM"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HNRNPM
Synonyms CEAR; hnRNP M; HNRNPM4; HNRPM; HNRPM4; HTGR1; NAGR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220513 representing NM_031203
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCAGGGGTCGAAGCGGCGGCGGAGGTGGCGGCGACGGAGATCAAAATGGAGGAAGAGAGCGGCG
CGCCCGGCGTGCCGAGCGGCAACGGGGCTCCGGGCCCTAAGGGTGAAGGAGAACGACCTGCTCAGAATGA
GAAGAGGAAGGAGAAAAACATAAAAAGAGGAGGCAATCGCTTTGAGCCATATGCCAATCCAACTAAAAGA
TACAGAGCCTTCATTACAAACATACCTTTTGATGTGAAATGGCAGTCACTTAAAGACCTGGTTAAAGAAA
AAGTTGGTGAGGTAACATACGTGGAGCTCTTAATGGACGCTGAAGGAAAGTCAAGGGGATGTGCTGTTGT
TGAATTCAAGATGGAAGAGAGCATGAAAAAAGCTGCGGAAGTCCTAAACAAGCATAGTCTGAGCGGAAGA
CCACTGAAAGTCAAAGAAGATCCTGATGGTGAACATGCCAGGAGAGCAATGCAAAAGGCTGGAAGACTTG
GAAGCACAGTATTTGTAGCAAATCTGGATTATAAAGTTGGCTGGAAGAAACTGAAGGAAGTATTTAGTAT
GGCTGGTGTGGTGGTCCGAGCAGACATTCTTGAAGATAAAGATGGAAAAAGTCGTGGAATAGGCACTGTT
ACTTTTGAACAGTCCATTGAAGCTGTGCAAGCTATATCTATGTTCAATGGCCAGCTGCTATTTGATAGAC
CAATGCACGTCAAGATGGATGAGAGGGCCTTACCAAAAGGAGATTTCTTCCCTCCTGAGCGTCCACAACA
ACTTCCCCATGGCCTTGGTGGTATTGGCATGGGGTTAGGACCAGGAGGGCAACCCATTGATGCCAATCAC
CTGAATAAAGGCATCGGAATGGGAAACATAGGTCCCGCAGGAATGGGAATGGAAGGCATAGGATTTGGAA
TAAATAAAATGGGAGGAATGGAGGGGCCCTTTGGTGGTGGTATGGAAAACATGGGTCGATTTGGATCTGG
GATGAACATGGGCAGGATAAATGAAATCCTAAGTAATGCACTGAAGAGAGGAGAGATCATTGCAAAGCAG
GGAGGAGGTGGAGGTGGAGGAAGCGTCCCTGGGATCGAGAGGATGGGTCCTGGCATTGACCGCCTCGGGG
GTGCCGGCATGGAGCGCATGGGCGCGGGCCTGGGCCACGGCATGGATCGCGTGGGCTCCGAGATCGAGCG
CATGGGCCTGGTCATGGACCGCATGGGCTCCGTGGAGCGCATGGGCTCCGGCATTGAGCGCATGGGCCCG
CTGGGCCTCGACCACATGGCCTCCAGCATTGAGCGCATGGGCCAGACCATGGAGCGCATTGGCTCTGGCG
TGGAGCGCATGGGTGCCGGCATGGGCTTCGGCCTTGAGCGCATGGCCGCTCCCATCGACCGTGTGGGCCA
GACCATTGAGCGCATGGGCTCTGGCGTGGAGCGCATGGGCCCTGCCATCGAGCGCATGGGCCTGAGCATG
GAGCGCATGGTGCCCGCAGGTATGGGAGCTGGCCTGGAGCGCATGGGCCCCGTGATGGATCGCATGGCCA
CCGGCCTGGAGCGCATGGGCGCCAACAATCTGGAGCGGATGGGCCTGGAGCGCATGGGCGCCAACAGCCT
CGAGCGCATGGGCCTGGAGCGCATGGGTGCCAACAGCCTCGAGCGCATGGGCCCCGCCATGGGCCCGGCC
CTGGGCGCTGGCATTGAGCGCATGGGCCTGGCCATGGGTGGCGGTGGCGGTGCCAGCTTTGACCGTGCCA
TCGAGATGGAGCGTGGCAACTTCGGAGGAAGCTTCGCAGGTTCCTTTGGTGGAGCTGGAGGCCATGCTCC
TGGGGTGGCCAGGAAGGCCTGCCAGATATTTGTGAGAAATCTGCCATTCGATTTCACATGGAAGATGCTA
AAGGACAAATTCAACGAGTGCGGCCACGTGCTGTACGCCGACATCAAGATGGAGAATGGGAAGTCCAAGG
GGTGTGGTGTGGTTAAGTTCGAGTCGCCAGAGGTGGCCGAGAGAGCCTGCCGGATGATGAATGGCATGAA
GCTGAGTGGCCGAGAGATTGACGTTCGAATTGATAGAAACGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220513 representing NM_031203
Red=Cloning site Green=Tags(s)

MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKR
YRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGR
PLKVKEDPDGEHARRAMQKAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTV
TFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANH
LNKGIGMGNIGPAGMGMEGIGFGINKMGGMEGPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQ
GGGGGGGSVPGIERMGPGIDRLGGAGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGP
LGLDHMASSIERMGQTMERIGSGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSM
ERMVPAGMGAGLERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPA
LGAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKML
KDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRNA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031203
ORF Size 2073 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_031203.4
RefSeq Size 2586 bp
RefSeq ORF 2076 bp
Locus ID 4670
UniProt ID P52272
Cytogenetics 19p13.2
Domains RRM
Protein Families Druggable Genome
Protein Pathways Spliceosome
MW 73.4 kDa
Gene Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.