TSH Receptor(TSHR) (NM_000369) Human Tagged ORF Clone

CAT#: RC220499

TSHR (Myc-DDK-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,164.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TSH Receptor(TSHR) (NM_000369) Human Tagged ORF Clone
Symbol TSHR
Synonyms CHNG1; hTSHR-I; LGR3
Vector pCMV6-Entry
Sequence Data
>RC220499 representing NM_000369
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCGGCGGACTTGCTGCAGCTGGTGCTGCTGCTCGACCTGCCCAGGGACCTGGGCGGAATGGGGT
GTTCGTCTCCACCCTGCGAGTGCCATCAGGAGGAGGACTTCAGAGTCACCTGCAAGGATATTCAACGCAT
CCCCAGCTTACCGCCCAGTACGCAGACTCTGAAGCTTATTGAGACTCACCTGAGAACTATTCCAAGTCAT
GCATTTTCTAATCTGCCCAATATTTCCAGAATCTACGTATCTATAGATGTGACTCTGCAGCAGCTGGAAT
CACACTCCTTCTACAATTTGAGTAAAGTGACTCACATAGAAATTCGGAATACCAGGAACTTAACTTACAT
AGACCCTGATGCCCTCAAAGAGCTCCCCCTCCTAAAGTTCCTTGGCATTTTCAACACTGGACTTAAAATG
TTCCCTGACCTGACCAAAGTTTATTCCACTGATATATTCTTTATACTTGAAATTACAGACAACCCTTACA
TGACGTCAATCCCTGTGAATGCTTTTCAGGGACTATGCAATGAAACCTTGACACTGAAGCTGTACAACAA
TGGCTTTACTTCAGTCCAAGGATATGCTTTCAATGGGACAAAGCTGGATGCTGTTTACCTAAACAAGAAT
AAATACCTGACAGTTATTGACAAAGATGCATTTGGAGGAGTATACAGTGGACCAAGCTTGCTGGACGTGT
CTCAAACCAGTGTCACTGCCCTTCCATCCAAAGGCCTGGAGCACCTGAAGGAACTGATAGCAAGAAACAC
CTGGACTCTTAAGAAACTTCCACTTTCCTTGAGTTTCCTTCACCTCACACGGGCTGACCTTTCTTACCCA
AGCCACTGCTGTGCTTTTAAGAATCAGAAGAAAATCAGAGGAATCCTTGAGTCCTTGATGTGTAATGAGA
GCAGTATGCAGAGCTTGCGCCAGAGAAAATCTGTGAATGCCTTGAATAGCCCCCTCCACCAGGAATATGA
AGAGAATCTGGGTGACAGCATTGTTGGGTACAAGGAAAAGTCCAAGTTCCAGGATACTCATAACAACGCT
CATTATTACGTCTTCTTTGAAGAACAAGAGGATGAGATCATTGGTTTTGGCCAGGAGCTCAAAAACCCCC
AGGAAGAGACTCTACAAGCTTTTGACAGCCATTATGACTACACCATATGTGGGGACAGTGAAGACATGGT
GTGTACCCCCAAGTCCGATGAGTTCAACCCGTGTGAAGACATAATGGGCTACAAGTTCCTGAGAATTGTG
GTGTGGTTCGTTAGTCTGCTGGCTCTCCTGGGCAATGTCTTTGTCCTGCTTATTCTCCTCACCAGCCACT
ACAAACTGAACGTCCCCCGCTTTCTCATGTGCAACCTGGCCTTTGCGGATTTCTGCATGGGGATGTACCT
GCTCCTCATCGCCTCTGTAGACCTCTACACTCACTCTGAGTACTACAACCATGCCATCGACTGGCAGACA
GGCCCTGGGTGCAACACGGCTGGTTTCTTCACTGTCTTTGCAAGCGAGTTATCGGTGTATACGCTGACGG
TCATCACCCTGGAGCGCTGGTATGCCATCACCTTCGCCATGCGCCTGGACCGGAAGATCCGCCTCAGGCA
CGCATGTGCCATCATGGTTGGGGGCTGGGTTTGCTGCTTCCTTCTCGCCCTGCTTCCTTTGGTGGGAATA
AGTAGCTATGCCAAAGTCAGTATCTGCCTGCCCATGGACACCGAGACCCCTCTTGCTCTGGCATATATTG
TTTTTGTTCTGACGCTCAACATAGTTGCCTTCGTCATCGTCTGCTGCTGTTATGTGAAGATCTACATCAC
AGTCCGAAATCCGCAGTACAACCCAGGGGACAAAGATACCAAAATTGCCAAGAGGATGGCTGTGTTGATC
TTCACCGACTTCATATGCATGGCCCCAATCTCATTCTATGCTCTGTCAGCAATTCTGAACAAGCCTCTCA
TCACTGTTAGCAACTCCAAAATCTTGCTGGTACTCTTCTATCCACTTAACTCCTGTGCCAATCCATTCCT
CTATGCTATTTTCACCAAGGCCTTCCAGAGGGATGTGTTCATCCTACTCAGCAAGTTTGGCATCTGTAAA
CGCCAGGCTCAGGCATACCGGGGGCAGAGGGTTCCTCCAAAGAACAGCACTGATATTCAGGTTCAAAAGG
TTACCCACGACATGAGGCAGGGTCTCCACAACATGGAAGATGTCTATGAACTGATTGAAAACTCCCATCT
AACCCCAAAGAAGCAAGGCCAAATCTCAGAAGAGTATATGCAAACGGTTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220499 representing NM_000369
Red=Cloning site Green=Tags(s)

MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH
AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM
FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN
KYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYP
SHCCAFKNQKKIRGILESLMCNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNA
HYYVFFEEQEDEIIGFGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQT
GPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCFLLALLPLVGI
SSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCCYVKIYITVRNPQYNPGDKDTKIAKRMAVLI
FTDFICMAPISFYALSAILNKPLITVSNSKILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICK
RQAQAYRGQRVPPKNSTDIQVQKVTHDMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000369
ORF Size 2292 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000369.1, NM_000369.2, NP_000360
RefSeq Size 4410
RefSeq ORF 2295
Locus ID 7253
Cytogenetics 14q31.1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction, Autoimmune thyroid disease
MW 86.83 kDa
Gene Summary The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)