Spastin (SPAST) (NM_014946) Human Tagged ORF Clone

CAT#: RC220458

Reviews ()
Write a review
  • TrueORF®

SPAST (Myc-DDK-tagged)-Human spastin (SPAST), transcript variant 1



  "NM_014946" in other vectors (6)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Spastin (SPAST) (NM_014946) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SPAST
Synonyms ADPSP; FSP2; SPG4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC220458 representing NM_014946
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATTCTCCGGGTGGACGAGGGAAGAAGAAAGGCTCCGGCGGCGCCAGCAACCCGGTGCCTCCCAGGC
CTCCGCCCCCTTGCCTGGCCCCCGCCCCTCCCGCCGCCGGGCCGGCCCCTCCGCCCGAGTCGCAGCATAA
GCGGAACCTGTACTATTTCTCCTACCCGCTGTTTGTAGGCTTCGCGCTGCTGCGTTTGGTCGCCTTCCAC
CTGGGGCTCCTCTTCGTGTGGCTCTGCCAGCGCTTCTCCCGCGCCCTCATGGCAGCCAAGAGGAGCTCCG
GGGCCGCGCCAGCACCTGCCTCGGCCTCGGCCCCGGCGCCGGTGCCGGGCGGCGAGGCCGAGCGCGTCCG
AGTCTTCCACAAACAGGCCTTCGAGTACATCTCCATTGCCCTGCGCATCGATGAGGATGAGAAAGCAGGA
CAGAAGGAGCAAGCTGTGGAATGGTATAAGAAAGGTATTGAAGAACTGGAAAAAGGAATAGCTGTTATAG
TTACAGGACAAGGTGAACAGTGTGAAAGAGCTAGACGCCTTCAAGCTAAAATGATGACTAATTTGGTTAT
GGCCAAGGACCGCTTACAACTTCTAGAGAAGATGCAACCAGTTTTGCCATTTTCCAAGTCACAAACGGAC
GTCTATAATGACAGTACTAACTTGGCATGCCGCAATGGACATCTCCAGTCAGAAAGTGGAGCTGTTCCAA
AAAGAAAAGACCCCTTAACACACACTAGTAATTCACTGCCTCGTTCAAAAACAGTTATGAAAACTGGATC
TGCAGGCCTTTCAGGCCACCATAGAGCACCTAGTTACAGTGGTTTATCCATGGTTTCTGGAGTGAAACAG
GGATCTGGTCCTGCTCCTACCACTCATAAGGGTACTCCGAAAACAAATAGGACAAATAAACCTTCTACCC
CTACAACTGCTACTCGTAAGAAAAAAGACTTGAAGAATTTTAGGAATGTGGACAGCAACCTTGCTAACCT
TATAATGAATGAAATTGTGGACAATGGAACAGCTGTTAAATTTGATGATATAGCTGGTCAAGACTTGGCA
AAACAAGCATTGCAAGAAATTGTTATTCTTCCTTCTCTGAGGCCTGAGTTGTTCACAGGGCTTAGAGCTC
CTGCCAGAGGGCTGTTACTCTTTGGTCCACCTGGGAATGGGAAGACAATGCTGGCTAAAGCAGTAGCTGC
AGAATCGAATGCAACCTTCTTTAATATAAGTGCTGCAAGTTTAACTTCAAAATACGTGGGAGAAGGAGAG
AAATTGGTGAGGGCTCTTTTTGCTGTGGCTCGAGAACTTCAACCTTCTATAATTTTTATAGATGAAGTTG
ATAGCCTTTTGTGTGAAAGAAGAGAAGGGGAGCACGATGCTAGTAGACGCCTAAAAACTGAATTTCTAAT
AGAATTTGATGGTGTACAGTCTGCTGGAGATGACAGAGTACTTGTAATGGGTGCAACTAATAGGCCACAA
GAGCTTGATGAGGCTGTTCTCAGGCGTTTCATCAAACGGGTATATGTGTCTTTACCAAATGAGGAGACAA
GACTACTTTTGCTTAAAAATCTGTTATGTAAACAAGGAAGTCCATTGACCCAAAAAGAACTAGCACAACT
TGCTAGAATGACTGATGGATACTCAGGAAGTGACCTAACAGCTTTGGCAAAAGATGCAGCACTGGGTCCT
ATCCGAGAACTAAAACCAGAACAGGTGAAGAATATGTCTGCCAGTGAGATGAGAAATATTCGATTATCTG
ACTTCACTGAATCCTTGAAAAAAATAAAACGCAGCGTCAGCCCTCAAACTTTAGAAGCGTACATACGTTG
GAACAAGGACTTTGGAGATACCACTGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220458 representing NM_014946
Red=Cloning site Green=Tags(s)

MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESQHKRNLYYFSYPLFVGFALLRLVAFH
LGLLFVWLCQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAG
QKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLEKMQPVLPFSKSQTD
VYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQ
GSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLA
KQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGE
KLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQ
ELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGP
IRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014946
ORF Size 1848 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014946.4
RefSeq Size 5221 bp
RefSeq ORF 1851 bp
Locus ID 6683
UniProt ID Q9UBP0, E5KRP5
Cytogenetics 2p22.3
Domains AAA, AAA, MIT
Protein Families Druggable Genome, Transmembrane
MW 67 kDa
Gene Summary This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The use of alternative translational initiation sites in this gene results in a single transcript variant that can produce isoforms that differ in the length of their N-terminus and which thereby differ in the efficiency of their export from the nucleus to the cytoplasm. In addition, alternative splicing results in multiple transcript variants that encode isoforms that differ in other protein regions as well. One isoform of this gene has been shown to be a microtubule-severing enzyme that regulates microtubule abundance, mobility, and plus-end distribution. Mutations in this gene cause the most frequent form of autosomal dominant spastic paraplegia 4. [provided by RefSeq, May 2018]

Other Versions

Other products for "SPAST"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-SPAST Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools