MTOR (NM_004958) Human Tagged ORF Clone

CAT#: RC220457

MTOR (Myc-DDK-tagged)-Human mechanistic target of rapamycin (serine/threonine kinase) (MTOR)

Change vector?

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name MTOR (NM_004958) Human Tagged ORF Clone
Symbol MTOR
Synonyms FRAP; FRAP1; FRAP2; RAFT1; RAPT1; SKS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC220457 representing NM_004958
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTGGAACCGGACCTGCCGCCGCCACCACCGCTGCCACCACATCTAGCAATGTGAGCGTCCTGCAGC
AGTTTGCCAGTGGCCTAAAGAGCCGGAATGAGGAAACCAGGGCCAAAGCCGCCAAGGAGCTCCAGCACTA
TGTCACCATGGAACTCCGAGAGATGAGTCAAGAGGAGTCTACTCGCTTCTATGACCAACTGAACCATCAC
ATTTTTGAATTGGTTTCCAGCTCAGATGCCAATGAGAGGAAAGGTGGCATCTTGGCCATAGCTAGCCTCA
TAGGAGTGGAAGGTGGGAATGCCACCCGAATTGGCAGATTTGCCAACTATCTTCGGAACCTCCTCCCCTC
CAATGACCCAGTTGTCATGGAAATGGCATCCAAGGCCATTGGCCGTCTTGCCATGGCAGGGGACACTTTT
ACCGCTGAGTACGTGGAATTTGAGGTGAAGCGAGCCCTGGAATGGCTGGGTGCTGACCGCAATGAGGGCC
GGAGACATGCAGCTGTCCTGGTTCTCCGTGAGCTGGCCATCAGCGTCCCTACCTTCTTCTTCCAGCAAGT
GCAACCCTTCTTTGACAACATTTTTGTGGCCGTGTGGGACCCCAAACAGGCCATCCGTGAGGGAGCTGTA
GCCGCCCTTCGTGCCTGTCTGATTCTCACAACCCAGCGTGAGCCGAAGGAGATGCAGAAGCCTCAGTGGT
ACAGGCACACATTTGAAGAAGCAGAGAAGGGATTTGATGAGACCTTGGCCAAAGAGAAGGGCATGAATCG
GGATGATCGGATCCATGGAGCCTTGTTGATCCTTAACGAGCTGGTCCGAATCAGCAGCATGGAGGGAGAG
CGTCTGAGAGAAGAAATGGAAGAAATCACACAGCAGCAGCTGGTACACGACAAGTACTGCAAAGATCTCA
TGGGCTTCGGAACAAAACCTCGTCACATTACCCCCTTCACCAGTTTCCAGGCTGTACAGCCCCAGCAGTC
AAATGCCTTGGTGGGGCTGCTGGGGTACAGCTCTCACCAAGGCCTCATGGGATTTGGGACCTCCCCCAGT
CCAGCTAAGTCCACCCTGGTGGAGAGCCGGTGTTGCAGAGACTTGATGGAGGAGAAATTTGATCAGGTGT
GCCAGTGGGTGCTGAAATGCAGGAATAGCAAGAACTCGCTGATCCAAATGACAATCCTTAATTTGTTGCC
CCGCTTGGCTGCATTCCGACCTTCTGCCTTCACAGATACCCAGTATCTCCAAGATACCATGAACCATGTC
CTAAGCTGTGTCAAGAAGGAGAAGGAACGTACAGCGGCCTTCCAAGCCCTGGGGCTACTTTCTGTGGCTG
TGAGGTCTGAGTTTAAGGTCTATTTGCCTCGCGTGCTGGACATCATCCGAGCGGCCCTGCCCCCAAAGGA
CTTCGCCCATAAGAGGCAGAAGGCAATGCAGGTGGACGCCACAGTCTTCACTTGCATCAGCATGCTGGCT
CGAGCAATGGGGCCAGGCATCCAGCAGGATATCAAGGAGCTGCTGGAGCCCATGCTGGCAGTGGGACTAA
GCCCTGCCCTCACTGCAGTGCTCTACGACCTGAGCCGTCAGATTCCACAGCTAAAGAAGGACATTCAAGA
TGGGCTACTGAAAATGCTGTCCCTGGTCCTTATGCACAAACCCCTTCGCCACCCAGGCATGCCCAAGGGC
CTGGCCCATCAGCTGGCCTCTCCTGGCCTCACGACCCTCCCTGAGGCCAGCGATGTGGGCAGCATCACTC
TTGCCCTCCGAACGCTTGGCAGCTTTGAATTTGAAGGCCACTCTCTGACCCAATTTGTTCGCCACTGTGC
GGATCATTTCCTGAACAGTGAGCACAAGGAGATCCGCATGGAGGCTGCCCGCACCTGCTCCCGCCTGCTC
ACACCCTCCATCCACCTCATCAGTGGCCATGCTCATGTGGTTAGCCAGACCGCAGTGCAAGTGGTGGCAG
ATGTGCTTAGCAAACTGCTCGTAGTTGGGATAACAGATCCTGACCCTGACATTCGCTACTGTGTCTTGGC
GTCCCTGGACGAGCGCTTTGATGCACACCTGGCCCAGGCGGAGAACTTGCAGGCCTTGTTTGTGGCTCTG
AATGACCAGGTGTTTGAGATCCGGGAGCTGGCCATCTGCACTGTGGGCCGACTCAGTAGCATGAACCCTG
CCTTTGTCATGCCTTTCCTGCGCAAGATGCTCATCCAGATTTTGACAGAGTTGGAGCACAGTGGGATTGG
AAGAATCAAAGAGCAGAGTGCCCGCATGCTGGGGCACCTGGTCTCCAATGCCCCCCGACTCATCCGCCCC
TACATGGAGCCTATTCTGAAGGCATTAATTTTGAAACTGAAAGATCCAGACCCTGATCCAAACCCAGGTG
TGATCAATAATGTCCTGGCAACAATAGGAGAATTGGCACAGGTTAGTGGCCTGGAAATGAGGAAATGGGT
TGATGAACTTTTTATTATCATCATGGACATGCTCCAGGATTCCTCTTTGTTGGCCAAAAGGCAGGTGGCT
CTGTGGACCCTGGGACAGTTGGTGGCCAGCACTGGCTATGTAGTAGAGCCCTACAGGAAGTACCCTACTT
TGCTTGAGGTGCTACTGAATTTTCTGAAGACTGAGCAGAACCAGGGTACACGCAGAGAGGCCATCCGTGT
GTTAGGGCTTTTAGGGGCTTTGGATCCTTACAAGCACAAAGTGAACATTGGCATGATAGACCAGTCCCGG
GATGCCTCTGCTGTCAGCCTGTCAGAATCCAAGTCAAGTCAGGATTCCTCTGACTATAGCACTAGTGAAA
TGCTGGTCAACATGGGAAACTTGCCTCTGGATGAGTTCTACCCAGCTGTGTCCATGGTGGCCCTGATGCG
GATCTTCCGAGACCAGTCACTCTCTCATCATCACACCATGGTTGTCCAGGCCATCACCTTCATCTTCAAG
TCCCTGGGACTCAAATGTGTGCAGTTCCTGCCCCAGGTCATGCCCACGTTCCTTAATGTCATTCGAGTCT
GTGATGGGGCCATCCGGGAATTTTTGTTCCAGCAGCTGGGAATGTTGGTGTCCTTTGTGAAGAGCCACAT
CAGACCTTATATGGATGAAATAGTCACCCTCATGAGAGAATTCTGGGTCATGAACACCTCAATTCAGAGC
ACGATCATTCTTCTCATTGAGCAAATTGTGGTAGCTCTTGGGGGTGAATTTAAGCTCTACCTGCCCCAGC
TGATCCCACACATGCTGCGTGTCTTCATGCATGACAACAGCCCAGGCCGCATTGTCTCTATCAAGTTACT
GGCTGCAATCCAGCTGTTTGGCGCCAACCTGGATGACTACCTGCATTTACTGCTGCCTCCTATTGTTAAG
TTGTTTGATGCCCCTGAAGCTCCACTGCCATCTCGAAAGGCAGCGCTAGAGACTGTGGACCGCCTGACGG
AGTCCCTGGATTTCACTGACTATGCCTCCCGGATCATTCACCCTATTGTTCGAACACTGGACCAGAGCCC
AGAACTGCGCTCCACAGCCATGGACACGCTGTCTTCACTTGTTTTTCAGCTGGGGAAGAAGTACCAAATT
TTCATTCCAATGGTGAATAAAGTTCTGGTGCGACACCGAATCAATCATCAGCGCTATGATGTGCTCATCT
GCAGAATTGTCAAGGGATACACACTTGCTGATGAAGAGGAGGATCCTTTGATTTACCAGCATCGGATGCT
TAGGAGTGGCCAAGGGGATGCATTGGCTAGTGGACCAGTGGAAACAGGACCCATGAAGAAACTGCACGTC
AGCACCATCAACCTCCAAAAGGCCTGGGGCGCTGCCAGGAGGGTCTCCAAAGATGACTGGCTGGAATGGC
TGAGACGGCTGAGCCTGGAGCTGCTGAAGGACTCATCATCGCCCTCCCTGCGCTCCTGCTGGGCCCTGGC
ACAGGCCTACAACCCGATGGCCAGGGATCTCTTCAATGCTGCATTTGTGTCCTGCTGGTCTGAACTGAAT
GAAGATCAACAGGATGAGCTCATCAGAAGCATCGAGTTGGCCCTCACCTCACAAGACATCGCTGAAGTCA
CACAGACCCTCTTAAACTTGGCTGAATTCATGGAACACAGTGACAAGGGCCCCCTGCCACTGAGAGATGA
CAATGGCATTGTTCTGCTGGGTGAGAGAGCTGCCAAGTGCCGAGCATATGCCAAAGCACTACACTACAAA
GAACTGGAGTTCCAGAAAGGCCCCACCCCTGCCATTCTAGAATCTCTCATCAGCATTAATAATAAGCTAC
AGCAGCCGGAGGCAGCGGCCGGAGTGTTAGAATATGCCATGAAACACTTTGGAGAGCTGGAGATCCAGGC
TACCTGGTATGAGAAACTGCACGAGTGGGAGGATGCCCTTGTGGCCTATGACAAGAAAATGGACACCAAC
AAGGACGACCCAGAGCTGATGCTGGGCCGCATGCGCTGCCTCGAGGCCTTGGGGGAATGGGGTCAACTCC
ACCAGCAGTGCTGTGAAAAGTGGACCCTGGTTAATGATGAGACCCAAGCCAAGATGGCCCGGATGGCTGC
TGCAGCTGCATGGGGTTTAGGTCAGTGGGACAGCATGGAAGAATACACCTGTATGATCCCTCGGGACACC
CATGATGGGGCATTTTATAGAGCTGTGCTGGCACTGCATCAGGACCTCTTCTCCTTGGCACAACAGTGCA
TTGACAAGGCCAGGGACCTGCTGGATGCTGAATTAACTGCAATGGCAGGAGAGAGTTACAGTCGGGCATA
TGGGGCCATGGTTTCTTGCCACATGCTGTCCGAGCTGGAGGAGGTTATCCAGTACAAACTTGTCCCCGAG
CGACGAGAGATCATCCGCCAGATCTGGTGGGAGAGACTGCAGGGCTGCCAGCGTATCGTAGAGGACTGGC
AGAAAATCCTTATGGTGCGGTCCCTTGTGGTCAGCCCTCATGAAGACATGAGAACCTGGCTCAAGTATGC
AAGCCTGTGCGGCAAGAGTGGCAGGCTGGCTCTTGCTCATAAAACTTTAGTGTTGCTCCTGGGAGTTGAT
CCGTCTCGGCAACTTGACCATCCTCTGCCAACAGTTCACCCTCAGGTGACCTATGCCTACATGAAAAACA
TGTGGAAGAGTGCCCGCAAGATCGATGCCTTCCAGCACATGCAGCATTTTGTCCAGACCATGCAGCAACA
GGCCCAGCATGCCATCGCTACTGAGGACCAGCAGCATAAGCAGGAACTGCACAAGCTCATGGCCCGATGC
TTCCTGAAACTTGGAGAGTGGCAGCTGAATCTACAGGGCATCAATGAGAGCACAATCCCCAAAGTGCTGC
AGTACTACAGCGCCGCCACAGAGCACGACCGCAGCTGGTACAAGGCCTGGCATGCGTGGGCAGTGATGAA
CTTCGAAGCTGTGCTACACTACAAACATCAGAACCAAGCCCGCGATGAGAAGAAGAAACTGCGTCATGCC
AGCGGGGCCAACATCACCAACGCCACCACTGCCGCCACCACGGCCGCCACTGCCACCACCACTGCCAGCA
CCGAGGGCAGCAACAGTGAGAGCGAGGCCGAGAGCACCGAGAACAGCCCCACCCCATCGCCGCTGCAGAA
GAAGGTCACTGAGGATCTGTCCAAAACCCTCCTGATGTACACGGTGCCTGCCGTCCAGGGCTTCTTCCGT
TCCATCTCCTTGTCACGAGGCAACAACCTCCAGGATACACTCAGAGTTCTCACCTTATGGTTTGATTATG
GTCACTGGCCAGATGTCAATGAGGCCTTAGTGGAGGGGGTGAAAGCCATCCAGATTGATACCTGGCTACA
GGTTATACCTCAGCTCATTGCAAGAATTGATACGCCCAGACCCTTGGTGGGACGTCTCATTCACCAGCTT
CTCACAGACATTGGTCGGTACCACCCCCAGGCCCTCATCTACCCACTGACAGTGGCTTCTAAGTCTACCA
CGACAGCCCGGCACAATGCAGCCAACAAGATTCTGAAGAACATGTGTGAGCACAGCAACACCCTGGTCCA
GCAGGCCATGATGGTGAGCGAGGAGCTGATCCGAGTGGCCATCCTCTGGCATGAGATGTGGCATGAAGGC
CTGGAAGAGGCATCTCGTTTGTACTTTGGGGAAAGGAACGTGAAAGGCATGTTTGAGGTGCTGGAGCCCT
TGCATGCTATGATGGAACGGGGCCCCCAGACTCTGAAGGAAACATCCTTTAATCAGGCCTATGGTCGAGA
TTTAATGGAGGCCCAAGAGTGGTGCAGGAAGTACATGAAATCAGGGAATGTCAAGGACCTCACCCAAGCC
TGGGACCTCTATTATCATGTGTTCCGACGAATCTCAAAGCAGCTGCCTCAGCTCACATCCTTAGAGCTGC
AATATGTTTCCCCAAAACTTCTGATGTGCCGGGACCTTGAATTGGCTGTGCCAGGAACATATGACCCCAA
CCAGCCAATCATTCGCATTCAGTCCATAGCACCGTCTTTGCAAGTCATCACATCCAAGCAGAGGCCCCGG
AAATTGACACTTATGGGCAGCAACGGACATGAGTTTGTTTTCCTTCTAAAAGGCCATGAAGATCTGCGCC
AGGATGAGCGTGTGATGCAGCTCTTCGGCCTGGTTAACACCCTTCTGGCCAATGACCCAACATCTCTTCG
GAAAAACCTCAGCATCCAGAGATACGCTGTCATCCCTTTATCGACCAACTCGGGCCTCATTGGCTGGGTT
CCCCACTGTGACACACTGCACGCCCTCATCCGGGACTACAGGGAGAAGAAGAAGATCCTTCTCAACATCG
AGCATCGCATCATGTTGCGGATGGCTCCGGACTATGACCACTTGACTCTGATGCAGAAGGTGGAGGTGTT
TGAGCATGCCGTCAATAATACAGCTGGGGACGACCTGGCCAAGCTGCTGTGGCTGAAAAGCCCCAGCTCC
GAGGTGTGGTTTGACCGAAGAACCAATTATACCCGTTCTTTAGCGGTCATGTCAATGGTTGGGTATATTT
TAGGCCTGGGAGATAGACACCCATCCAACCTGATGCTGGACCGTCTGAGTGGGAAGATCCTGCACATTGA
CTTTGGGGACTGCTTTGAGGTTGCTATGACCCGAGAGAAGTTTCCAGAGAAGATTCCATTTAGACTAACA
AGAATGTTGACCAATGCTATGGAGGTTACAGGCCTGGATGGCAACTACAGAATCACATGCCACACAGTGA
TGGAGGTGCTGCGAGAGCACAAGGACAGTGTCATGGCCGTGCTGGAAGCCTTTGTCTATGACCCCTTGCT
GAACTGGAGGCTGATGGACACAAATACCAAAGGCAACAAGCGATCCCGAACGAGGACGGATTCCTACTCT
GCTGGCCAGTCAGTCGAAATTTTGGACGGTGTGGAACTTGGAGAGCCAGCCCATAAGAAAACGGGGACCA
CAGTGCCAGAATCTATTCATTCTTTCATTGGAGACGGTTTGGTGAAACCAGAGGCCCTAAATAAGAAAGC
TATCCAGATTATTAACAGGGTTCGAGATAAGCTCACTGGTCGGGACTTCTCTCATGATGACACTTTGGAT
GTTCCAACGCAAGTTGAGCTGCTCATCAAACAAGCGACATCCCATGAAAACCTCTGCCAGTGCTATATTG
GCTGGTGCCCTTTCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220457 representing NM_004958
Red=Cloning site Green=Tags(s)

MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHH
IFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTF
TAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAV
AALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGE
RLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPS
PAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLA
RAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKG
LAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLL
TPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVAL
NDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRP
YMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSR
DASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFK
SLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQS
TIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVK
LFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQI
FIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELN
EDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYK
ELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTN
KDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDT
HDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPE
RREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARC
FLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHA
SGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFR
SISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQL
LTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEG
LEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPR
KLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWV
PHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSS
EVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLT
RMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYS
AGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004958
ORF Size 7647 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004958.1, NM_004958.2, NM_004958.3, NP_004949
RefSeq Size 8680
RefSeq ORF 7650
Locus ID 2475
Cytogenetics 1p36.22
Protein Families Protein Kinase, Druggable Genome
Protein Pathways ErbB signaling pathway, mTOR signaling pathway, Insulin signaling pathway, Adipocytokine signaling pathway, Type II diabetes mellitus, Pathways in cancer, Glioma, Prostate cancer, Acute myeloid leukemia
MW 288.7 kDa
Gene Summary The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. [provided by RefSeq, Sep 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations