ENSA (NM_207042) Human Tagged ORF Clone

CAT#: RC220441

ENSA (Myc-DDK-tagged)-Human endosulfine alpha (ENSA), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ENSA (NM_207042) Human Tagged ORF Clone
Symbol ENSA
Synonyms ARPP-19e; ARPP-19e
Vector pCMV6-Entry
Sequence Data
>RC220441 representing NM_207042
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCAGAAACAAGAAGAAGAGAACCCTGCGGAGGAGACCGGCGAGGAGAAGCAGGACACGCAGGAGA
AAGAAGGTATTCTGCCTGAGAGAGCTGAAGAGGCAAAGCTAAAGGCCAAATACCCAAGCCTAGGACAAAA
GCCTGGAGGCTCCGACTTCCTCATGAAGAGACTCCAGAAAGGGGATTATAAATCATTACATTGGAGTGTG
CTTCTCTGTGCGGATGAAATGCAAAAGTACTTTGACTCAGGAGACTACAACATGGCCAAAGCCAAGATGA
AGAATAAGCAGCTGCCAAGTGCAGGACCAGACAAGAACCTGGTGACTGGTGATCACATCCCCACCCCACA
GGATCTGCCCCAGAGAAAGTCCTCGCTCGTCACCAGCAAGCTTGCGGGTGGCCAAGTTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220441 representing NM_207042
Red=Cloning site Green=Tags(s)

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGDYKSLHWSV
LLCADEMQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_207042
ORF Size 411 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_207042.1, NP_996925
RefSeq Size 1300
RefSeq ORF 414
Locus ID 2029
Cytogenetics 1q21.3
Protein Families Druggable Genome
MW 15.1 kDa
Gene Summary The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)