Liver Carboxylesterase 1(CES1) (NM_001266) Human Tagged ORF Clone

CAT#: RC220398

CES1 (Myc-DDK-tagged)-Human carboxylesterase 1 (CES1), transcript variant 3

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Liver Carboxylesterase 1(CES1) (NM_001266) Human Tagged ORF Clone
Symbol CES1
Synonyms ACAT; CE-1; CEH; CES2; hCE-1; HMSE; HMSE1; PCE-1; REH; SES1; TGH
Vector pCMV6-Entry
Sequence Data
>RC220398 representing NM_001266
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCTCCGTGCCTTTATCCTGGCCACTCTCTCTGCTTCCGCGGCTTGGGGGCATCCGTCCTCGCCAC
CTGTGGTGGACACCGTGCATGGCAAAGTGCTGGGGAAGTTCGTCAGCTTAGAAGGATTTGCACAGCCTGT
GGCCATTTTCCTGGGAATCCCTTTTGCCAAGCCGCCTCTTGGACCCCTGAGGTTTACTCCACCGCAGCCT
GCAGAACCATGGAGCTTTGTGAAGAATGCCACCTCGTACCCTCCTATGTGCACCCAAGATCCCAAGGCGG
GGCAGTTACTCTCAGAGCTATTTACAAACCGAAAGGAGAACATTCCTCTCAAGCTTTCTGAAGACTGTCT
TTACCTCAATATTTACACTCCTGCTGACTTGACCAAGAAAAACAGGCTGCCGGTGATGGTGTGGATCCAC
GGAGGGGGGCTGATGGTGGGTGCGGCATCAACCTATGATGGGCTGGCCCTTGCTGCCCATGAAAACGTGG
TGGTGGTGACCATTCAATATCGCCTGGGCATCTGGGGATTCTTCAGCACAGGGGATGAACACAGCCGGGG
GAACTGGGGTCACCTGGACCAGGTGGCTGCCCTGCGCTGGGTCCAGGACAACATTGCCAGCTTTGGAGGG
AACCCAGGCTCTGTGACCATCTTTGGAGAGTCAGCGGGAGGAGAAAGTGTCTCTGTTCTTGTTTTGTCTC
CATTGGCCAAGAACCTCTTCCACCGGGCCATTTCTGAGAGTGGCGTGGCCCTCACTTCTGTTCTGGTGAA
GAAAGGTGATGTCAAGCCCTTGGCTGAGCAAATTGCTATCACTGCTGGGTGCAAAACCACCACCTCTGCT
GTCATGGTTCACTGCCTGCGACAGAAGACGGAAGAGGAGCTCTTGGAGACGACATTGAAAATGAAATTCT
TATCTCTGGACTTACAGGGAGACCCCAGAGAGAGTCAACCCCTTCTGGGCACTGTGATTGATGGGATGCT
GCTGCTGAAAACACCTGAAGAGCTTCAAGCTGAAAGGAATTTCCACACTGTCCCCTACATGGTCGGAATT
AACAAGCAGGAGTTTGGCTGGTTGATTCCAATGTTGATGAGCTATCCACTCTCCGAAGGGCAACTGGACC
AGAAGACAGCCATGTCACTCCTGTGGAAGTCCTATCCCCTTGTTTGCATTGCTAAGGAACTGATTCCAGA
AGCCACTGAGAAATACTTAGGAGGAACAGACGACACTGTCAAAAAGAAAGACCTGTTCCTGGACTTGATA
GCAGATGTGATGTTTGGTGTCCCATCTGTGATTGTGGCCCGGAACCACAGAGATGCTGGAGCACCCACCT
ACATGTATGAGTTTCAGTACCGTCCAAGCTTCTCATCAGACATGAAACCCAAGACGGTGATAGGAGACCA
CGGGGATGAGCTCTTCTCCGTCTTTGGGGCCCCATTTTTAAAAGAGGGTGCCTCAGAAGAGGAGATCAGA
CTTAGCAAGATGGTGATGAAATTCTGGGCCAACTTTGCTCGCAATGGAAACCCCAATGGGGAAGGGCTGC
CCCACTGGCCAGAGTACAACCAGAAGGAAGGGTATCTGCAGATTGGTGCCAACACCCAGGCGGCCCAGAA
GCTGAAGGACAAAGAAGTAGCTTTCTGGACCAACCTCTTTGCCAAGAAGGCAGTGGAGAAGCCACCCCAG
ACAGAACACATAGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220398 representing NM_001266
Red=Cloning site Green=Tags(s)

MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQP
AEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIH
GGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGG
NPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA
VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGI
NKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLI
ADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIR
LSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ
TEHIEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001266
ORF Size 1698 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001266.2, NM_001266.3, NM_001266.4, NP_001257
RefSeq Size 2021
RefSeq ORF 1701
Locus ID 1066
Cytogenetics 16q12.2
Domains COesterase
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes
MW 62.39 kDa
Gene Summary This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jun 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)