Kv beta 1 (KCNAB1) (NM_172160) Human Tagged ORF Clone

CAT#: RC220389

Reviews ()
Write a review

KCNAB1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, shaker-related subfamily, beta member 1 (KCNAB1), transcript variant 1

  View "NM_172160" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Kv beta 1 (KCNAB1) (NM_172160) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNAB1
Synonyms AKR6A3; hKvb3; hKvBeta3; KCNA1B; KV-BETA-1; Kvb1.3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC220389 representing NM_172160
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGCAGCCCGGACAGGGGCAGCGGGGAGTCAGATCTCAGAGGAGAACACCAAGTTAAGGAGACAGT
CTGGGTTTTCTGTAGCAGGGAAAGACAAATCTCCCAAGAAAGCCTCAGAAAACGCTAAAGACAGCAGCCT
TAGTCCCTCAGGGGAAAGCCAGCTCAGGGCGCGTCAACTGGCTCTGCTGCGCGAAGTGGAGATGAACTGG
TACCTAAAGCTCTGCGACCTGTCCAGCGAGCACACCACCGTCTGCACCACAGGCATGCCGCACAGGAATC
TTGGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTCAAATTTC
AGATGAGGTTGCTGAACGGCTGATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAA
GTCTATGCTGCTGGAAAGGCTGAAGTGATTCTGGGGAGCATCATCAAGAAGAAAGGCTGGAGGAGGTCCA
GTCTGGTCATAACAACCAAACTCTACTGGGGTGGAAAAGCTGAAACAGAAAGAGGGCTGTCAAGAAAGCA
TATTATTGAAGGATTGAAGGGCTCCCTCCAGAGGCTGCAGCTCGAGTATGTGGATGTGGTCTTTGCAAAT
CGACCGGACAGTAACACTCCCATGGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGG
CGATGTACTGGGGCACCTCGAGATGGAGTGCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTT
CAATATGATCCCACCGGTCTGTGAACAAGCTGAGTACCATCTTTTCCAGAGAGAGAAAGTGGAGGTCCAG
CTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACATGGTCTCCACTTGCCTGTGGAATCATCT
CAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGTTGAAAGA
AAGAATTGTAAGTGAAGAAGGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGT
CTGGGATGCACACTACCTCAGCTAGCTGTTGCGTGGTGCCTGAGAAATGAAGGTGTGAGTTCTGTGCTCC
TGGGATCATCCACTCCTGAACAACTCATTGAAAACCTTGGTGCCATTCAGGTTCTCCCAAAGATGACATC
ACATGTGGTAAATGAGATTGATAACATACTGCGCAACAAGCCCTACAGCAAGAAGGACTATAGATCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220389 representing NM_172160
Red=Cloning site Green=Tags(s)

MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQLALLREVEMNW
YLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAE
VYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFAN
RPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQ
LPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAER
LGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_172160
ORF Size 1257 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172160.1, NM_172160.2, NP_751892.1
RefSeq Size 3170
RefSeq ORF 1260
Locus ID 7881
Cytogenetics 3q25.31
Protein Families Druggable Genome, Ion Channels: Other
MW 46.4 kDa
Gene Summary Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member includes distinct isoforms which are encoded by alternatively spliced transcript variants of this gene. Some of these isoforms are beta subunits, which form heteromultimeric complexes with alpha subunits and modulate the activity of the pore-forming alpha subunits. [provided by RefSeq, Apr 2015]

Other Versions

Other products for "KCNAB1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


KCNAB1 (Kv beta 1) mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones