eRF1(ETF1) (NM_004730) Human Tagged ORF Clone

CAT#: RC220387

ETF1 (Myc-DDK-tagged)-Human eukaryotic translation termination factor 1 (ETF1)

Need custom modification / cloning service?
Get a free quote

USD 567.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name eRF1(ETF1) (NM_004730) Human Tagged ORF Clone
Symbol ETF1
Synonyms D5S1995; ERF; ERF1; RF1; SUP45L1; TB3-1
Vector pCMV6-Entry
Sequence Data
>RC220387 representing NM_004730
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGACCCCAGTGCTGCCGACAGGAACGTGGAGATCTGGAAGATCAAGAAGCTCATTAAGAGCT
TGGAGGCGGCCCGCGGCAATGGCACCAGCATGATATCATTGATCATTCCTCCCAAAGACCAGATTTCACG
AGTGGCAAAAATGTTAGCGGATGAGTTTGGAACTGCATCTAACATTAAGTCACGAGTAAACCGCCTTTCA
GTCCTGGGAGCCATTACATCTGTACAACAAAGACTCAAACTTTATAACAAAGTACCTCCAAATGGTCTGG
TTGTATACTGTGGAACAATTGTAACAGAAGAAGGAAAGGAAAAGAAAGTCAACATTGACTTTGAACCTTT
CAAACCAATTAATACGTCATTGTATTTGTGTGACAACAAATTCCATACAGAGGCTCTTACAGCACTACTT
TCAGATGATAGCAAGTTTGGATTCATTGTAATAGATGGTAGTGGTGCACTTTTTGGCACACTCCAAGGAA
ACACAAGAGAAGTCCTGCACAAATTCACTGTGGATCTCCCAAAGAAACACGGTAGAGGAGGTCAGTCAGC
CTTGCGTTTTGCCCGTTTAAGAATGGAAAAGCGACATAACTATGTTCGGAAAGTAGCAGAGACTGCTGTG
CAGCTGTTTATTTCTGGGGACAAAGTGAATGTGGCTGGTCTAGTTTTAGCTGGATCCGCTGACTTTAAAA
CTGAACTAAGTCAATCTGATATGTTTGATCAGAGGTTACAATCAAAAGTTTTAAAATTAGTTGATATATC
CTATGGTGGTGAAAATGGATTCAACCAAGCTATTGAGTTATCTACTGAAGTCCTCTCCAACGTGAAATTC
ATTCAAGAGAAGAAATTAATAGGACGATACTTTGATGAAATCAGCCAGGACACGGGCAAGTACTGTTTTG
GCGTTGAAGATACACTAAAGGCTTTGGAAATGGGAGCTGTAGAAATTCTAATAGTCTATGAAAATCTGGA
TATAATGAGATATGTTCTTCATTGCCAAGGCACAGAAGAGGAGAAAATTCTCTATCTAACTCCAGAGCAA
GAAAAGGATAAATCTCATTTCACAGACAAAGAGACCGGACAGGAACATGAGCTTATCGAGAGCATGCCCC
TGTTGGAATGGTTTGCTAACAACTATAAAAAATTTGGAGCTACGTTGGAAATTGTCACAGATAAATCACA
AGAAGGGTCTCAGTTTGTGAAAGGATTTGGTGGAATTGGAGGTATCTTGCGGTACCGAGTAGATTTCCAG
GGAATGGAATACCAAGGAGGAGACGATGAATTTTTTGACCTTGATGACTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220387 representing NM_004730
Red=Cloning site Green=Tags(s)

MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLS
VLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALL
SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAV
QLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKF
IQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQ
EKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004730
ORF Size 1311 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004730.1, NM_004730.2, NM_004730.3, NP_004721
RefSeq Size 3653
RefSeq ORF 1314
Locus ID 2107
Cytogenetics 5q31.2
Domains eRF1_1, eRF1_2, eRF1_3
MW 48.9 kDa
Gene Summary This gene encodes a class-1 polypeptide chain release factor. The encoded protein plays an essential role in directing termination of mRNA translation from the termination codons UAA, UAG and UGA. This protein is a component of the SURF complex which promotes degradation of prematurely terminated mRNAs via the mechanism of nonsense-mediated mRNA decay (NMD). Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 6, 7, and X. [provided by RefSeq, Aug 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)