eRF1 (ETF1) (NM_004730) Human Tagged ORF Clone

CAT#: RC220387

Reviews ()
Write a review

ETF1 (Myc-DDK-tagged)-Human eukaryotic translation termination factor 1 (ETF1)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ETF1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ETF1
Synonyms D5S1995; ERF; ERF1; RF1; SUP45L1; TB3-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220387 representing NM_004730
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGACCCCAGTGCTGCCGACAGGAACGTGGAGATCTGGAAGATCAAGAAGCTCATTAAGAGCT
TGGAGGCGGCCCGCGGCAATGGCACCAGCATGATATCATTGATCATTCCTCCCAAAGACCAGATTTCACG
AGTGGCAAAAATGTTAGCGGATGAGTTTGGAACTGCATCTAACATTAAGTCACGAGTAAACCGCCTTTCA
GTCCTGGGAGCCATTACATCTGTACAACAAAGACTCAAACTTTATAACAAAGTACCTCCAAATGGTCTGG
TTGTATACTGTGGAACAATTGTAACAGAAGAAGGAAAGGAAAAGAAAGTCAACATTGACTTTGAACCTTT
CAAACCAATTAATACGTCATTGTATTTGTGTGACAACAAATTCCATACAGAGGCTCTTACAGCACTACTT
TCAGATGATAGCAAGTTTGGATTCATTGTAATAGATGGTAGTGGTGCACTTTTTGGCACACTCCAAGGAA
ACACAAGAGAAGTCCTGCACAAATTCACTGTGGATCTCCCAAAGAAACACGGTAGAGGAGGTCAGTCAGC
CTTGCGTTTTGCCCGTTTAAGAATGGAAAAGCGACATAACTATGTTCGGAAAGTAGCAGAGACTGCTGTG
CAGCTGTTTATTTCTGGGGACAAAGTGAATGTGGCTGGTCTAGTTTTAGCTGGATCCGCTGACTTTAAAA
CTGAACTAAGTCAATCTGATATGTTTGATCAGAGGTTACAATCAAAAGTTTTAAAATTAGTTGATATATC
CTATGGTGGTGAAAATGGATTCAACCAAGCTATTGAGTTATCTACTGAAGTCCTCTCCAACGTGAAATTC
ATTCAAGAGAAGAAATTAATAGGACGATACTTTGATGAAATCAGCCAGGACACGGGCAAGTACTGTTTTG
GCGTTGAAGATACACTAAAGGCTTTGGAAATGGGAGCTGTAGAAATTCTAATAGTCTATGAAAATCTGGA
TATAATGAGATATGTTCTTCATTGCCAAGGCACAGAAGAGGAGAAAATTCTCTATCTAACTCCAGAGCAA
GAAAAGGATAAATCTCATTTCACAGACAAAGAGACCGGACAGGAACATGAGCTTATCGAGAGCATGCCCC
TGTTGGAATGGTTTGCTAACAACTATAAAAAATTTGGAGCTACGTTGGAAATTGTCACAGATAAATCACA
AGAAGGGTCTCAGTTTGTGAAAGGATTTGGTGGAATTGGAGGTATCTTGCGGTACCGAGTAGATTTCCAG
GGAATGGAATACCAAGGAGGAGACGATGAATTTTTTGACCTTGATGACTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220387 representing NM_004730
Red=Cloning site Green=Tags(s)

MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLS
VLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALL
SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAV
QLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKF
IQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQ
EKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004730
ORF Size 1311 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004730.4
RefSeq Size 3653 bp
RefSeq ORF 1314 bp
Locus ID 2107
UniProt ID P62495
Cytogenetics 5q31.2
Domains eRF1_1, eRF1_2, eRF1_3
MW 48.9 kDa
Gene Summary This gene encodes a class-1 polypeptide chain release factor. The encoded protein plays an essential role in directing termination of mRNA translation from the termination codons UAA, UAG and UGA. This protein is a component of the SURF complex which promotes degradation of prematurely terminated mRNAs via the mechanism of nonsense-mediated mRNA decay (NMD). Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 6, 7, and X. [provided by RefSeq, Aug 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.