PKA R2 (PRKAR2A) (NM_004157) Human Tagged ORF Clone

CAT#: RC220376

Reviews ()
Write a review

PRKAR2A (Myc-DDK-tagged)-Human protein kinase, cAMP-dependent, regulatory, type II, alpha (PRKAR2A)



  "NM_004157" in other vectors (6)

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PRKAR2A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRKAR2A
Synonyms PKR2; PRKAR2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220376 representing NM_004157
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCACATCCAGATCCCGCCGGGGCTCACGGAGCTGCTGCAGGGCTACACGGTGGAGGTGCTGCGAC
AGCAGCCGCCTGACCTCGTCGAATTCGCAGTGGAGTACTTCACCCGCCTGCGCGAGGCCCGCGCCCCAGC
CTCAGTCCTGCCCGCCGCCACCCCACGCCAGAGCCTGGGCCACCCCCCGCCAGAACCCGGCCCGGACCGT
GTCGCCGACGCCAAAGGGGACAGCGAGTCGGAGGAGGACGAGGACTTGGAAGTTCCAGTTCCTAGCAGAT
TTAATAGACGAGTATCAGTCTGTGCTGAGACCTATAACCCTGATGAGGAAGAGGAAGATACAGATCCAAG
GGTGATTCATCCTAAAACTGATGAACAGAGATGCAGACTTCAGGAAGCTTGCAAAGATATTCTCCTTTTC
AAAAATCTTGATCAGGAACAGCTTTCTCAAGTTCTCGATGCCATGTTTGAAAGGATAGTCAAAGCTGATG
AGCATGTCATTGACCAAGGAGATGATGGAGACAACTTTTATGTCATAGAACGGGGAACTTATGACATTTT
AGTAACAAAAGATAATCAAACCCGCTCTGTTGGTCAATATGACAACCGTGGCAGTTTTGGAGAACTAGCT
CTGATGTACAACACCCCGAGAGCTGCTACCATTGTTGCTACCTCAGAAGGCTCCCTTTGGGGACTGGACC
GGGTGACTTTTAGAAGAATCATAGTGAAAAATAATGCAAAGAAGAGGAAGATGTTTGAATCATTTATTGA
GTCTGTGCCCCTCCTTAAATCACTAGAGGTGTCAGAACGAATGAAGATTGTGGATGTAATAGGAGAGAAG
ATCTATAAGGATGGAGAACGCATAATCACTCAGGGTGAAAAGGCTGATAGCTTTTACATCATAGAGTCTG
GCGAAGTGAGCATCTTGATTAGAAGCAGGACTAAATCAAACAAGGATGGTGGGAACCAGGAGGTCGAGAT
TGCCCGCTGCCATAAGGGGCAGTACTTTGGAGAGCTTGCCCTGGTCACCAACAAACCCAGAGCTGCCTCA
GCTTATGCAGTTGGAGATGTCAAATGCTTAGTTATGGATGTACAAGCATTCGAGAGGCTTCTGGGGCCCT
GCATGGACATCATGAAGAGGAACATCTCACACTATGAGGAACAGCTGGTGAAGATGTTTGGCTCCAGCGT
GGATCTGGGCAACCTCGGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220376 representing NM_004157
Red=Cloning site Green=Tags(s)

MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDR
VADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLF
KNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELA
LMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEK
IYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS
AYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004157
ORF Size 1212 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004157.4
RefSeq Size 2381 bp
RefSeq ORF 1215 bp
Locus ID 5576
UniProt ID P13861
Cytogenetics 3p21.31
Domains cNMP, RIIa
Protein Families Druggable Genome
Protein Pathways Apoptosis, Insulin signaling pathway
MW 45.3 kDa
Gene Summary cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER). [provided by RefSeq, Jul 2008]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.