ETV3L (NM_001004341) Human Tagged ORF Clone

CAT#: RC220315

ETV3L (Myc-DDK-tagged)-Human ets variant 3-like (ETV3L)

Need custom modification / cloning service?
Get a free quote

USD 454.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ETV3L (NM_001004341) Human Tagged ORF Clone
Symbol ETV3L
Synonyms FLJ16478
Vector pCMV6-Entry
Sequence Data
>RC220315 representing NM_001004341
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACTGCAGCTGCTTGGCTGAGGGCATCCCAGCCAACCCCGGCAACTGGATCTCAGGGTTGGCCTTCC
CTGATTGGGCCTACAAAGCCGAGTCGTCCCCAGGCTCCCGGCAGATCCAGCTGTGGCACTTCATCCTGGA
GCTGCTGCAGAAGGAAGAGTTCCGCCATGTCATCGCCTGGCAGCAGGGAGAGTACGGGGAATTTGTCATC
AAGGATCCAGATGAGGTGGCCCGCCTCTGGGGCCGCAGGAAATGCAAACCACAGATGAATTATGACAAGC
TGAGCCGGGCCCTCAGATATTACTACAATAAGAGGATCCTGCATAAGACCAAAGGCAAAAGGTTCACATA
CAAGTTCAACTTCAGCAAGCTCATCGTAGTCAACTATCCTTTGTGGGAAGTGCGGGCGCCGCCATCCCCC
CACTTGCTGCTGGGGGCCCCTGCCCTGTGTCGGCCAGCGCTGGTGCCCGTGGGTGTGCAGAGTGAGCTCC
TGCACAGCATGCTATTTGCCCATCAGGCCATGGTGGAGCAGCTGACAGGACAGCAGACCCCCCGAGGGCC
ACCAGAGACCTCTGGGGATAAGAAGGGGAGCAGCAGCAGCGTCTACCGACTTGGCTCTGCCCCAGGCCCC
TGCCGGCTGGGCCTTTGCTGCCATTTGGGGAGCGTCCAAGGCGAGCTGCCTGGTGTTGCCTCCTTCACTC
CTCCCCTCCCGCCCCCTCTGCCCTCCAACTGGACCTGTCTCTCGGGGCCCTTCTTGCCTCCTCTCCCGTC
AGAGCAGCAGCTCCCAGGGGCTTTTAAGCCAGACATCCTGCTCCCAGGACCTAGGAGCCTCCCAGGGGCC
TGGCATTTTCCAGGGCTTCCTCTCTTGGCAGGGCTGGGACAGGGTGCGGGTGAGAGGCTTTGGCTCTTGT
CCCTCAGGCCCGAGGGGCTGGAAGTAAAGCCTGCTCCCATGATGGAGGCAAAGGGAGGCCTGGATCCCAG
GGAGGTCTTCTGCCCAGAGACCCGCAGACTCAAAACTGGGGAGGAAAGCCTTACTTCCCCCAATCTGGAG
AACCTCAAAGCAGTGTGGCCCTTGGATCCTCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220315 representing NM_001004341
Red=Cloning site Green=Tags(s)

MHCSCLAEGIPANPGNWISGLAFPDWAYKAESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVI
KDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFSKLIVVNYPLWEVRAPPSP
HLLLGAPALCRPALVPVGVQSELLHSMLFAHQAMVEQLTGQQTPRGPPETSGDKKGSSSSVYRLGSAPGP
CRLGLCCHLGSVQGELPGVASFTPPLPPPLPSNWTCLSGPFLPPLPSEQQLPGAFKPDILLPGPRSLPGA
WHFPGLPLLAGLGQGAGERLWLLSLRPEGLEVKPAPMMEAKGGLDPREVFCPETRRLKTGEESLTSPNLE
NLKAVWPLDPP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001004341
ORF Size 1083 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001004341.1, NM_001004341.2, NP_001004341
RefSeq Size 1976
RefSeq ORF 1086
Locus ID 440695
Cytogenetics 1q23.1
MW 39.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)