TRPV4 (NM_021625) Human Tagged ORF Clone

CAT#: RC220160

Reviews ()
Write a review

TRPV4 (Myc-DDK-tagged)-Human transient receptor potential cation channel, subfamily V, member 4 (TRPV4), transcript variant 1



  "NM_021625" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRPV4
Synonyms BCYM3; CMT2C; HMSN2C; OTRPC4; SMAL; SPSMA; SSQTL1; TRP12; VRL2; VROAC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220160 representing NM_021625
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATTCCAGCGAAGGCCCCCGCGCGGGGCCCGGGGAGGTGGCTGAGCTCCCCGGGGATGAGAGTG
GCACCCCAGGCGGGGAGGCTTTTCCTCTCTCCTCCCTGGCCAATCTGTTTGAGGGGGAGGATGGCTCCCT
TTCGCCCTCACCGGCTGATGCCAGTCGCCCTGCTGGCCCAGGCGATGGGCGACCAAATCTGCGCATGAAG
TTCCAGGGCGCCTTCCGCAAGGGGGTGCCCAACCCCATCGATCTGCTGGAGTCCACCCTATATGAGTCCT
CGGTGGTGCCTGGGCCCAAGAAAGCACCCATGGACTCACTGTTTGACTACGGCACCTATCGTCACCACTC
CAGTGACAACAAGAGGTGGAGGAAGAAGATCATAGAGAAGCAGCCACAGAGCCCCAAAGCCCCTGCCCCT
CAGCCGCCCCCCATCCTCAAAGTCTTCAACCGGCCTATCCTCTTTGACATCGTGTCCCGGGGCTCCACTG
CTGACCTGGACGGGCTGCTCCCATTCTTGCTGACCCACAAGAAACGCCTAACTGATGAGGAGTTTCGAGA
GCCATCTACGGGGAAGACCTGCCTGCCCAAGGCCTTGCTGAACCTGAGCAATGGCCGCAACGACACCATC
CCTGTGCTGCTGGACATCGCGGAGCGCACCGGCAACATGCGGGAGTTCATTAACTCGCCCTTCCGTGACA
TCTACTATCGAGGTCAGACAGCCCTGCACATCGCCATTGAGCGTCGCTGCAAACACTACGTGGAACTTCT
CGTGGCCCAGGGAGCTGATGTCCACGCCCAGGCCCGTGGGCGCTTCTTCCAGCCCAAGGATGAGGGGGGC
TACTTCTACTTTGGGGAGCTGCCCCTGTCGCTGGCTGCCTGCACCAACCAGCCCCACATTGTCAACTACC
TGACGGAGAACCCCCACAAGAAGGCGGACATGCGGCGCCAGGACTCGCGAGGCAACACAGTGCTGCATGC
GCTGGTGGCCATTGCTGACAACACCCGTGAGAACACCAAGTTTGTTACCAAGATGTACGACCTGCTGCTG
CTCAAGTGTGCCCGCCTCTTCCCCGACAGCAACCTGGAGGCCGTGCTCAACAACGACGGCCTCTCGCCCC
TCATGATGGCTGCCAAGACGGGCAAGATTGGGATCTTTCAGCACATCATCCGGCGGGAGGTGACGGATGA
GGACACACGGCACCTGTCCCGCAAGTTCAAGGACTGGGCCTATGGGCCAGTGTATTCCTCGCTTTATGAC
CTCTCCTCCCTGGACACGTGTGGGGAAGAGGCCTCCGTGCTGGAGATCCTGGTGTACAACAGCAAGATTG
AGAACCGCCACGAGATGCTGGCTGTGGAGCCCATCAATGAACTGCTGCGGGACAAGTGGCGCAAGTTCGG
GGCCGTCTCCTTCTACATCAACGTGGTCTCCTACCTGTGTGCCATGGTCATCTTCACTCTCACCGCCTAC
TACCAGCCGCTGGAGGGCACACCGCCGTACCCTTACCGCACCACGGTGGACTACCTGCGGCTGGCTGGCG
AGGTCATTACGCTCTTCACTGGGGTCCTGTTCTTCTTCACCAACATCAAAGACTTGTTCATGAAGAAATG
CCCTGGAGTGAATTCTCTCTTCATTGATGGCTCCTTCCAGCTGCTCTACTTCATCTACTCTGTCCTGGTG
ATCGTCTCAGCAGCCCTCTACCTGGCAGGGATCGAGGCCTACCTGGCCGTGATGGTCTTTGCCCTGGTCC
TGGGCTGGATGAATGCCCTTTACTTCACCCGTGGGCTGAAGCTGACGGGGACCTATAGCATCATGATCCA
GAAGATTCTCTTCAAGGACCTTTTCCGATTCCTGCTCGTCTACTTGCTCTTCATGATCGGCTACGCTTCA
GCCCTGGTCTCCCTCCTGAACCCGTGTGCCAACATGAAGGTGTGCAATGAGGACCAGACCAACTGCACAG
TGCCCACTTACCCCTCGTGCCGTGACAGCGAGACCTTCAGCACCTTCCTCCTGGACCTGTTTAAGCTGAC
CATCGGCATGGGCGACCTGGAGATGCTGAGCAGCACCAAGTACCCCGTGGTCTTCATCATCCTGCTGGTG
ACCTACATCATCCTCACCTTTGTGCTGCTCCTCAACATGCTCATTGCCCTCATGGGCGAGACAGTGGGCC
AGGTCTCCAAGGAGAGCAAGCACATCTGGAAGCTGCAGTGGGCCACCACCATCCTGGACATTGAGCGCTC
CTTCCCCGTATTCCTGAGGAAGGCCTTCCGCTCTGGGGAGATGGTCACCGTGGGCAAGAGCTCGGACGGC
ACTCCTGACCGCAGGTGGTGCTTCAGGGTGGATGAGGTGAACTGGTCTCACTGGAACCAGAACTTGGGCA
TCATCAACGAGGACCCGGGCAAGAATGAGACCTACCAGTATTATGGCTTCTCGCATACCGTGGGCCGCCT
CCGCAGGGATCGCTGGTCCTCGGTGGTACCCCGCGTGGTGGAACTGAACAAGAACTCGAACCCGGACGAG
GTGGTGGTGCCTCTGGACAGCATGGGGAACCCCCGCTGCGATGGCCACCAGCAGGGTTACCCCCGCAAGT
GGAGGACTGATGACGCCCCGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220160 representing NM_021625
Red=Cloning site Green=Tags(s)

MADSSEGPRAGPGEVAELPGDESGTPGGEAFPLSSLANLFEGEDGSLSPSPADASRPAGPGDGRPNLRMK
FQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHSSDNKRWRKKIIEKQPQSPKAPAP
QPPPILKVFNRPILFDIVSRGSTADLDGLLPFLLTHKKRLTDEEFREPSTGKTCLPKALLNLSNGRNDTI
PVLLDIAERTGNMREFINSPFRDIYYRGQTALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGG
YFYFGELPLSLAACTNQPHIVNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLL
LKCARLFPDSNLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLCAMVIFTLTAY
YQPLEGTPPYPYRTTVDYLRLAGEVITLFTGVLFFFTNIKDLFMKKCPGVNSLFIDGSFQLLYFIYSVLV
IVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMIQKILFKDLFRFLLVYLLFMIGYAS
ALVSLLNPCANMKVCNEDQTNCTVPTYPSCRDSETFSTFLLDLFKLTIGMGDLEMLSSTKYPVVFIILLV
TYIILTFVLLLNMLIALMGETVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDG
TPDRRWCFRVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDE
VVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021625
ORF Size 2613 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021625.5
RefSeq Size 3254 bp
RefSeq ORF 2616 bp
Locus ID 59341
UniProt ID Q9HBA0
Cytogenetics 12q24.11
Domains ANK, ion_trans
Protein Families Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane
MW 98.1 kDa
Gene Summary This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

Other Versions

Other products for "TRPV4"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Anti-TRPV4 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.