KCNA5 (NM_002234) Human Tagged ORF Clone

CAT#: RC219793

Reviews ()
Write a review

KCNA5 (Myc-DDK-tagged)-Human potassium voltage-gated channel, shaker-related subfamily, member 5 (KCNA5)



Reconstitution Protocol

USD 856.00

In Stock*

Size
    • 10 ug

Product images

Other products for "KCNA5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNA5
Synonyms ATFB7; HCK1; HK2; HPCN1; KV1.5; PCN1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219793 representing NM_002234
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGATCGCCCTGGTGCCCCTGGAGAACGGCGGTGCCATGACCGTCAGAGGAGGCGATGAGGCCCGGG
CAGGCTGCGGCCAGGCCACAGGGGGAGAGCTCCAGTGTCCCCCGACGGCTGGGCTCAGCGATGGGCCCAA
GGAGCCGGCGCCAAAGGGGCGCGGCGCGCAGAGAGACGCGGACTCGGGAGTGCGGCCCTTGCCTCCGCTG
CCGGACCCGGGAGTGCGGCCCTTGCCTCCGCTGCCAGAGGAGCTGCCACGGCCTCGACGGCCGCCTCCCG
AGGACGAGGAGGAAGAAGGCGATCCCGGCCTGGGCACGGTGGAGGACCAGGCTCTGGGCACGGCGTCCCT
GCACCACCAGCGCGTCCACATCAACATCTCCGGGCTGCGCTTTGAGACGCAGCTGGGCACCCTGGCGCAG
TTCCCCAACACACTCCTGGGGGACCCCGCCAAGCGCCTGCGCTACTTCGACCCCCTGAGGAACGAGTACT
TCTTCGACCGCAACCGGCCCAGCTTCGACGGTATCCTCTACTACTACCAGTCCGGGGGCCGCCTGCGGAG
GCCGGTCAACGTCTCCCTGGACGTGTTCGCGGACGAGATACGCTTCTACCAGCTGGGGGACGAGGCCATG
GAGCGCTTCCGCGAGGATGAGGGCTTCATTAAAGAAGAGGAGAAGCCCCTGCCCCGCAACGAGTTCCAGC
GCCAGGTGTGGCTTATCTTCGAGTATCCGGAGAGCTCTGGGTCCGCGCGGGCCATCGCCATCGTCTCGGT
CTTGGTTATCCTCATCTCCATCATCACCTTCTGCTTGGAGACCCTGCCTGAGTTCAGGGATGAACGTGAG
CTGCTCCGCCACCCTCCGGCGCCCCACCAGCCTCCCGCGCCCGCCCCTGGGGCCAACGGCAGCGGGGTCA
TGGCCCCGCCCTCTGGCCCTACGGTGGCACCGCTCCTGCCCAGGACCCTGGCCGACCCCTTCTTCATCGT
GGAGACCACGTGCGTCATCTGGTTCACCTTCGAGCTGCTCGTGCGCTTCTTCGCCTGCCCCAGCAAGGCA
GGGTTCTCCCGGAACATCATGAACATCATCGATGTGGTGGCCATCTTCCCCTACTTCATCACCCTGGGCA
CCGAACTGGCAGAGCAGCAGCCAGGGGGCGGAGGAGGCGGCCAGAATGGGCAGCAGGCCATGTCCCTGGC
CATCCTCCGAGTCATCCGCCTGGTCCGGGTGTTCCGCATCTTCAAGCTCTCCCGCCACTCCAAGGGGCTG
CAGATCCTGGGCAAGACCTTGCAGGCCTCCATGAGGGAGCTGGGGCTGCTCATCTTCTTCCTCTTCATCG
GGGTCATCCTCTTCTCCAGTGCCGTCTACTTCGCAGAGGCTGACAACCAGGGAACCCATTTCTCTAGCAT
CCCTGACGCCTTCTGGTGGGCAGTGGTCACCATGACCACTGTGGGCTACGGGGACATGAGGCCCATCACT
GTTGGGGGCAAGATCGTGGGCTCGCTGTGTGCCATCGCCGGGGTCCTCACCATTGCCCTGCCTGTGCCCG
TCATCGTCTCCAACTTCAACTACTTCTACCACCGGGAAACGGATCACGAGGAGCCGGCAGTCCTTAAGGA
AGAGCAGGGCACTCAGAGCCAGGGGCCGGGGCTGGACAGAGGAGTCCAGCGGAAGGTCAGCGGGAGCAGG
GGATCCTTCTGCAAGGCTGGGGGGACCCTGGAGAATGCAGACAGTGCCCGAAGGGGCAGCTGCCCCCTAG
AGAAGTGTAACGTCAAGGCCAAGAGCAACGTGGACTTGCGGAGGTCCCTTTATGCCCTCTGCCTGGACAC
CAGCCGGGAAACAGATTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219793 representing NM_002234
Red=Cloning site Green=Tags(s)

MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADSGVRPLPPL
PDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQRVHINISGLRFETQLGTLAQ
FPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAM
ERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERE
LLRHPPAPHQPPAPAPGANGSGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKA
GFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTTVGYGDMRPIT
VGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQGTQSQGPGLDRGVQRKVSGSR
GSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSLYALCLDTSRETDL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002234
ORF Size 1839 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002234.4
RefSeq Size 2865 bp
RefSeq ORF 1842 bp
Locus ID 3741
UniProt ID P22460
Cytogenetics 12p13.32
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 67 kDa
Gene Summary Potassium channels represent the most complex class of voltage-gated ino channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, the function of which could restore the resting membrane potential of beta cells after depolarization and thereby contribute to the regulation of insulin secretion. This gene is intronless, and the gene is clustered with genes KCNA1 and KCNA6 on chromosome 12. Defects in this gene are a cause of familial atrial fibrillation type 7 (ATFB7). [provided by RefSeq, May 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.