AMOTL2 (NM_016201) Human Tagged ORF Clone

CAT#: RC219781

AMOTL2 (Myc-DDK-tagged)-Human angiomotin like 2 (AMOTL2)

Clone Modification / Custom Cloning Service

USD 1,195.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AMOTL2 (NM_016201) Human Tagged ORF Clone
Symbol AMOTL2
Synonyms LCCP
Vector pCMV6-Entry
Sequence Data
>RC219781 representing NM_016201
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACACTGGAAGACTCCTCGGGGACAGTCCTGCACCGCCTCATCCAGGAGCAGCTGCGCTACGGCA
ACCTGACTGAGACGCGCACGCTGCTAGCCATCCAGCAGCAGGCCCTGAGGGGTGGGGCTGGAACTGGGGG
TACAGGGAGCCCCCAGGCCTCCCTGGAGATCCTGGCCCCAGAGGACAGTCAGGTGCTGCAGCAGGCCACC
AGGCAGGAGCCCCAGGGCCAGGAGCACCAGGGCGGTGAGAACCACCTGGCAGAGAACACCCTCTACCGGC
TATGCCCACAGCCCAGCAAGGGAGAGGAGCTGCCCACCTATGAGGAGGCCAAAGCCCACTCGCAGTACTA
TGCGGCCCAGCAGGCAGGGACCCGGCCACATGCGGGGGACCGAGATCCCCGTGGGGCCCCGGGAGGCAGT
CGGAGGCAGGACGAGGCCCTGCGGGAGCTGAGGCATGGGCACGTGCGCTCGTTGAGTGAACGGCTCCTTC
AGTTGTCCCTGGAGAGGAACGGCGCCCGGGCCCCCAGCCACATGAGCTCCTCCCACAGCTTCCCACAGCT
GGCCCGCAACCAGCAGGGCCCCCCACTGAGGGGCCCCCCTGCTGAGGGCCCAGAGTCCCGAGGACCCCCA
CCTCAGTACCCTCATGTTGTACTAGCTCATGAGACCACCACTGCTGTCACTGACCCACGGTACCGTGCCC
GCGGCAGCCCGCACTTCCAGCATGCTGAAGTCAGGATCCTGCAGGCCCAGGTGCCTCCTGTGTTCCTCCA
ACAGCAGCAGCAGTACCAGTACCTGCAGCAATCTCAGGAGCACCCCCCTCCCCCACATCCAGCTGCTCTC
GGCCATGGCCCCCTGAGCTCCCTCAGTCCACCTGCTGTGGAGGGGCCAGTGAGTGCCCAGGCCTCCTCAG
CCACCTCGGGCAGTGCCCACCTGGCCCAGATGGAGGCCGTGCTGAGGGAGAATGCCAGGCTGCAGAGAGA
CAATGAGCGGCTGCAGAGGGAGCTGGAGAGCTCTGCGGAGAAGGCTGGCCGCATTGAGAAGCTGGAAAGC
GAAATCCAGCGGCTCTCTGAGGCCCATGAGAGCCTGACCAGAGCCTCCTCCAAGCGTGAGGCCCTGGAGA
AGACCATGCGGAACAAGATGGACAGTGAAATGAGGAGGCTGCAAGACTTCAACCGGGATCTTAGAGAGAG
ATTGGAATCTGCAAATCGCCGCCTGGCAAGCAAGACACAGGAGGCCCAGGCCGGCAGTCAGGACATGGTG
GCCAAGCTGCTTGCTCAGAGCTACGAACAGCAGCAGGAGCAAGAGAAGCTGGAGCGAGAGATGGCACTGC
TGCGCGGCGCCATCGAGGACCAGCGGCGGCGTGCCGAGCTGCTGGAGCAGGCTCTGGGCAATGCGCAGGG
CCGGGCAGCTCGAGCCGAAGAGGAGCTGCGCAAGAAGCAGGCCTATGTGGAGAAAGTGGAGCGGCTGCAG
CAGGCGCTCGGGCAGCTGCAGGCAGCCTGTGAGAAGCGGGAGCAGCTGGAGCTGCGTCTGCGGACTCGCC
TGGAGCAGGAACTCAAGGCCCTGCGTGCACAGCAGAGACAGGCAGGTGCCCCAGGTGGTAGCAGTGGCAG
TGGTGGGTCTCCAGAGCTCAGCGCCCTGCGACTGTCAGAACAACTGCGAGAGAAGGAGGAGCAGATCCTG
GCGCTGGAGGCCGACATGACCAAGTGGGAGCAGAAGTATTTGGAGGAACGTGCCATGAGGCAGTTTGCCA
TGGATGCGGCTGCCACGGCTGCTGCTCAGCGTGACACCACTCTCATCCGACATTCCCCCCAGCCCTCACC
CAGCAGCAGCTTCAATGAGGGTCTGCTCACTGGTGGCCACAGGCATCAGGAGATGGAAAGCAGGTTAAAG
GTGCTCCATGCCCAGATCCTGGAGAAGGATGCAGTGATCAAGGTCCTTCAGCAGCGCTCCAGGAGAGACC
CTGGCAAGGCCATCCAGGGCTCCCTGCGGCCTGCCAAGTCGGTGCCATCTGTTTTCGCGGCTGCGGCAGC
AGGAACCCAGGGCTGGCAAGGGCTCTCTTCTAGTGAGCGACAAACAGCAGACGCCCCTGCTCGGCTGACT
ACAGCAGACAGAGCACCCACAGAGGAGCCAGTGGTCACAGCTCCCCCTGCTGCCCATGCCAAACACGGGA
GCAGAGATGGGAGCACCCAGACTGAGGGCCCCCCAGACAGCACCTCCACCTGCCTGCCACCGGAGCCTGA
CAGCCTTCTGGGGTGCAGCAGTAGCCAGAGAGCAGCCTCTCTGGACTCTGTAGCTACATCCAGAGTCCAG
GACTTGTCAGACATGGTGGAGATACTGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219781 representing NM_016201
Red=Cloning site Green=Tags(s)

MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGTGGTGSPQASLEILAPEDSQVLQQAT
RQEPQGQEHQGGENHLAENTLYRLCPQPSKGEELPTYEEAKAHSQYYAAQQAGTRPHAGDRDPRGAPGGS
RRQDEALRELRHGHVRSLSERLLQLSLERNGARAPSHMSSSHSFPQLARNQQGPPLRGPPAEGPESRGPP
PQYPHVVLAHETTTAVTDPRYRARGSPHFQHAEVRILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAAL
GHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLES
EIQRLSEAHESLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMV
AKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALGNAQGRAARAEEELRKKQAYVEKVERLQ
QALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQAGAPGGSSGSGGSPELSALRLSEQLREKEEQIL
ALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLK
VLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLT
TADRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQ
DLSDMVEILI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016201
ORF Size 2340 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016201.2, NM_016201.3, NP_057285
RefSeq Size 4984
RefSeq ORF 2343
Locus ID 51421
Cytogenetics 3q22.2
MW 85.7 kDa
Gene Summary Angiomotin is a protein that binds angiostatin, a circulating inhibitor of the formation of new blood vessels (angiogenesis). Angiomotin mediates angiostatin inhibition of endothelial cell migration and tube formation in vitro. The protein encoded by this gene is related to angiomotin and is a member of the motin protein family. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)