WNT11 (NM_004626) Human Tagged ORF Clone

CAT#: RC219688

WNT11 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 11 (WNT11)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_004626" in other vectors (6)

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
    • 100 ul

USD 533.00

Other products for "WNT11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol WNT11
Synonyms HWNT11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219688 representing NM_004626
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGCGCGGCCGCAGGTCTGCGAGGCGCTGCTCTTCGCCCTGGCGCTCCAGACCGGCGTGTGCTATG
GCATCAAGTGGCTGGCGCTGTCCAAGACACCATCGGCCCTGGCACTGAACCAGACGCAACACTGCAAGCA
GCTGGAGGGTCTGGTGTCTGCACAGGTGCAGCTGTGCCGCAGCAACCTGGAGCTCATGCACACGGTGGTG
CACGCCGCCCGCGAGGTCATGAAGGCCTGTCGCCGGGCCTTTGCCGACATGCGCTGGAACTGCTCCTCCA
TTGAGCTCGCCCCCAACTATTTGCTTGACCTGGAGAGAGGGACCCGGGAGTCGGCCTTCGTGTATGCGCT
GTCGGCCGCCGCCATCAGCCACGCCATCGCCCGGGCCTGCACCTCCGGCGACCTGCCCGGCTGCTCCTGC
GGCCCCGTCCCAGGTGAGCCACCCGGACCCGGGAACCGCTGGGGAGGATGTGCGGACAACCTCAGCTACG
GGCTCCTCATGGGGGCCAAGTTTTCCGATGCTCCTATGAAGGTGAAAAAAACAGGATCCCAAGCCAATAA
ACTGATGCGTCTACACAACAGTGAAGTGGGGAGACAGGCTCTGCGCGCCTCTCTGGAAATGAAGTGTAAG
TGCCATGGGGTGTCTGGCTCCTGCTCCATCCGCACCTGCTGGAAGGGGCTGCAGGAGCTGCAGGATGTGG
CTGCTGACCTCAAGACCCGATACCTGTCGGCCACCAAGGTAGTGCACCGACCCATGGGCACCCGCAAGCA
CCTGGTGCCCAAGGACCTGGATATCCGGCCTGTGAAGGACTCGGAACTCGTCTATCTGCAGAGCTCACCT
GACTTCTGCATGAAGAATGAGAAGGTGGGCTCCCACGGGACACAAGACAGGCAGTGCAACAAGACATCCA
ACGGAAGCGACAGCTGCGACCTTATGTGCTGCGGGCGTGGCTACAACCCCTACACAGACCGCGTGGTCGA
GCGGTGCCACTGTAAGTACCACTGGTGCTGCTACGTCACCTGCCGCAGGTGTGAGCGTACCGTGGAGCGC
TATGTCTGCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219688 representing NM_004626
Red=Cloning site Green=Tags(s)

MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVV
HAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSC
GPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCK
CHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSP
DFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVER
YVCK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004626
ORF Size 1062 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004626.3
RefSeq Size 1927 bp
RefSeq ORF 1065 bp
Locus ID 7481
UniProt ID O96014
Cytogenetics 11q13.5
Protein Families Secreted Protein, Transmembrane
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway
MW 39.18 kDa
Gene Summary The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 97%, 85%, and 63% amino acid identity with mouse, chicken, and Xenopus Wnt11 protein, respectively. This gene may play roles in the development of skeleton, kidney and lung, and is considered to be a plausible candidate gene for High Bone Mass Syndrome. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.