Junctophilin 2 (JPH2) (NM_020433) Human Tagged ORF Clone

CAT#: RC219661

Reviews ()
Write a review

JPH2 (Myc-DDK-tagged)-Human junctophilin 2 (JPH2), transcript variant 1



  "NM_020433" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol JPH2
Synonyms CMH17; JP-2; JP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219661 representing NM_020433
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGGGGGCCGCTTCGACTTTGATGATGGAGGGGCGTACTGCGGGGGCTGGGAGGGGGGAAAGGCCC
ATGGGCATGGACTGTGCACAGGCCCCAAGGGCCAGGGCGAATACTCTGGCTCCTGGAACTTTGGCTTTGA
GGTGGCAGGTGTCTACACCTGGCCCAGCGGAAACACCTTTGAGGGATACTGGAGCCAGGGCAAACGGCAT
GGGCTGGGCATAGAGACCAAGGGGCGCTGGCTCTACAAGGGCGAGTGGACACATGGCTTCAAGGGACGCT
ACGGAATCCGGCAGAGCTCAAGCAGCGGTGCCAAGTATGAGGGCACCTGGAACAATGGCCTGCAAGACGG
CTATGGCACCGAGACCTATGCTGATGGAGGGACGTACCAAGGCCAGTTCACCAACGGCATGCGCCATGGC
TACGGAGTACGCCAGAGCGTGCCCTACGGGATGGCCGTGGTGGTGCGCTCGCCGCTGCGCACGTCGCTGT
CGTCCCTGCGCAGCGAGCACAGCAACGGCACGGTGGCCCCGGACTCTCCCGCCTCGCCGGCCTCCGACGG
CCCCGCGCTGCCCTCGCCCGCCATCCCGCGTGGCGGCTTCGCGCTCAGCCTCCTGGCCAATGCCGAGGCG
GCCGCGCGGGCGCCCAAGGGCGGCGGCCTCTTCCAGCGGGGCGCGCTGCTGGGCAAGCTGCGGCGCGCAG
AGTCGCGCACGTCCGTGGGTAGCCAGCGCAGCCGTGTCAGCTTCCTTAAGAGCGACCTCAGCTCGGGCGC
CAGCGACGCCGCGTCCACCGCCAGCCTGGGAGAGGCCGCCGAGGGCGCCGACGAGGCCGCACCCTTCGAG
GCCGATATCGACGCCACCACCACCGAGACCTACATGGGCGAGTGGAAGAACGACAAACGCTCGGGCTTCG
GCGTGAGCGAACGCTCCAGTGGCCTCCGCTACGAGGGCGAGTGGCTGGACAACCTGCGCCACGGCTATGG
CTGCACCACGCTGCCCGACGGCCACCGCGAGGAGGGCAAGTACCGCCACAACGTGCTGGTCAAGGACACC
AAGCGCCGCATGCTGCAGCTCAAGAGCAACAAGGTCCGCCAGAAAGTGGAGCACAGTGTGGAGGGTGCCC
AGCGCGCCGCTGCTATCGCGCGCCAGAAGGCCGAGATTGCCGCCTCCAGGACAAGCCACGCCAAGGCCAA
AGCTGAGGCAGCGGAACAGGCCGCCCTGGCTGCCAACCAGGAGTCCAACATTGCTCGCACTTTGGCCAGG
GAGCTGGCTCCGGACTTCTACCAGCCAGGTCCGGAATATCAGAAGCGCCGGCTGCTGCAGGAGATCCTGG
AGAACTCGGAGAGCCTGCTGGAGCCCCCCGACCGGGGCGCCGGCGCAGCGGGCCTCCCACAGCCGCCCCG
CGAGAGCCCGCAGCTGCACGAGCGTGAGACCCCTCGGCCCGAGGGTGGCTCCCCGTCACCGGCCGGGACG
CCCCCGCAGCCCAAGCGGCCCAGGCCCGGGGTGTCCAAGGACGGCCTGCTGAGCCCAGGCGCCTGGAACG
GCGAGCCCAGCGGTGAGGGCAGCCGGTCAGTCACTCCGTCCGAGGGCGCGGGCCGCCGCAGCCCCGCGCG
TCCAGCCACCGAGCGCATGGCCATCGAGGCTCTGCAGGCACCGCCTGCGCCGTCGCGGGAGCCGGAGGTG
GCGCTTTACCAGGGCTACCACAGCTATGCTGTGCGCACCACGCCGCCCGAGCCCCCACCCTTTGAGGACC
AGCCCGAGCCCGAGGTCTCCGGGTCCGAGTCCGCGCCCTCGTCCCCGGCCACCGCCCCGCTGCAGGCCCC
CACGCTCCGAGGCCCCGAGCCTGCACGCGAGACCCCCGCCAAGCTGGAGCCCAAGCCCATCATCCCCAAA
GCCGAGCCCAGGGCCAAGGCCCGCAAGACTGAGGCTCGAGGGCTGACCAAGGCGGGGGCCAAGAAGAAGG
CGCGGAAGGAGGCCGCACTGGCGGCAGAGGCGGAGGTGGAGGTGGAAGAGGTCCCCAACACCATCCTCAT
CTGCATGGTGATCCTGCTGAACATCGGCCTGGCCATCCTCTTTGTTCACCTCCTGACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219661 representing NM_020433
Red=Cloning site Green=Tags(s)

MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRH
GLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHG
YGVRQSVPYGMAVVVRSPLRTSLSSLRSEHSNGTVAPDSPASPASDGPALPSPAIPRGGFALSLLANAEA
AARAPKGGGLFQRGALLGKLRRAESRTSVGSQRSRVSFLKSDLSSGASDAASTASLGEAAEGADEAAPFE
ADIDATTTETYMGEWKNDKRSGFGVSERSSGLRYEGEWLDNLRHGYGCTTLPDGHREEGKYRHNVLVKDT
KRRMLQLKSNKVRQKVEHSVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQESNIARTLAR
ELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGAGAAGLPQPPRESPQLHERETPRPEGGSPSPAGT
PPQPKRPRPGVSKDGLLSPGAWNGEPSGEGSRSVTPSEGAGRRSPARPATERMAIEALQAPPAPSREPEV
ALYQGYHSYAVRTTPPEPPPFEDQPEPEVSGSESAPSSPATAPLQAPTLRGPEPARETPAKLEPKPIIPK
AEPRAKARKTEARGLTKAGAKKKARKEAALAAEAEVEVEEVPNTILICMVILLNIGLAILFVHLLT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020433
ORF Size 2088 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020433.5
RefSeq Size 4802 bp
RefSeq ORF 2091 bp
Locus ID 57158
UniProt ID Q9BR39
Cytogenetics 20q13.12
Protein Families Transmembrane
MW 74 kDa
Gene Summary Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. This gene is a member of the junctophilin gene family. Alternative splicing has been observed at this locus and two variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "JPH2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


JPH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.