PDE3B (NM_000922) Human Tagged ORF Clone

CAT#: RC219619

Reviews ()
Write a review

PDE3B (Myc-DDK-tagged)-Human phosphodiesterase 3B, cGMP-inhibited (PDE3B)



Reconstitution Protocol

USD 968.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PDE3B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDE3B
Synonyms cGIPDE1; HcGIP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219619 representing NM_000922
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAGGGACGAGCGAGACGCCAAAGCCATGCGGTCCCTGCAGCCGCCGGATGGGGCCGGCTCGCCCC
CCGAGAGTCTGAGGAACGGCTACGTGAAGAGCTGCGTGAGCCCCTTGCGGCAGGACCCTCCGCGCGGCTT
CTTCTTCCACCTCTGCCGCTTCTGCAACGTGGAGCTGCGGCCGCCGCCGGCCTCTCCCCAGCAGCCGCGG
CGCTGCTCCCCCTTCTGCCGGGCGCGCCTCTCGCTGGGCGCCCTGGCTGCCTTTGTCCTCGCCCTGCTGC
TGGGCGCGGAACCCGAGAGCTGGGCTGCCGGGGCCGCCTGGCTGCGGACGCTGCTGAGCGTGTGTTCGCA
CAGCTTGAGCCCCCTCTTCAGCATCGCCTGTGCCTTCTTCTTCCTCACCTGCTTCCTCACCCGGACCAAG
CGGGGACCCGGCCCGGGCCGGAGCTGCGGCTCCTGGTGGCTGCTGGCGCTGCCCGCCTGCTGTTACCTGG
GGGACTTCTTGGTGTGGCAGTGGTGGTCTTGGCCTTGGGGGGATGGCGACGCAGGGTCCGCGGCCCCGCA
CACGCCCCCGGAGGCGGCAGCGGGCAGGTTGCTGCTGGTGCTGAGCTGCGTAGGGCTGCTGCTGACGCTC
GCGCACCCGCTGCGGCTCCGGCACTGCGTTCTGGTGCTGCTCCTGGCCAGCTTCGTCTGGTGGGTCTCCT
TCACCAGCCTCGGGTCGCTGCCCTCCGCCCTCAGGCCGCTGCTCTCCGGCCTGGTGGGGGGCGCTGGCTG
CCTGCTGGCCCTGGGGTTGGATCACTTCTTTCAAATCAGGGAAGCGCCTCTTCATCCTCGACTGTCCAGT
GCCGCCGAAGAAAAAGTGCCTGTGATCCGACCCCGGAGGAGGTCCAGCTGCGTGTCGTTAGGAGAAACTG
CAGCCAGTTACTATGGCAGTTGCAAAATATTCAGGAGACCGTCGTTGCCTTGTATTTCCAGAGAACAGAT
GATTCTTTGGGATTGGGACTTAAAACAATGGTATAAGCCTCATTATCAAAATTCTGGAGGTGGAAATGGA
GTTGATCTTTCAGTGCTAAATGAGGCTCGCAATATGGTGTCAGATCTTCTGACTGATCCAAGCCTTCCAC
CACAAGTCATTTCCTCTCTACGGAGTATTAGTAGCTTAATGGGTGCTTTCTCAGGTTCCTGTAGGCCAAA
GATTAATCCTCTCACACCATTTCCTGGATTTTACCCCTGTTCTGAAATAGAGGACCCAGCTGAGAAAGGG
GATAGAAAACTTAACAAGGGACTAAATAGGAATAGTTTGCCAACTCCACAGCTGAGGAGAAGCTCAGGAA
CTTCAGGATTGCTACCTGTTGAACAGTCTTCAAGGTGGGATCGTAATAATGGCAAAAGACCTCACCAAGA
ATTTGGCATTTCAAGTCAAGGATGCTATCTAAATGGGCCTTTTAATTCAAATCTACTGACTATCCCGAAG
CAAAGGTCATCTTCTGTATCACTGACTCACCATGTAGGTCTCAGAAGAGCTGGTGTTTTGTCCAGTCTGA
GTCCTGTGAATTCTTCCAACCATGGACCAGTGTCTACTGGCTCTCTAACTAATCGATCACCCATAGAATT
TCCTGATACTGCTGATTTTCTTAATAAGCCAAGCGTTATCTTGCAGAGATCTCTGGGCAATGCACCTAAT
ACTCCAGATTTTTATCAGCAACTTAGAAATTCTGATAGCAATCTGTGTAACAGCTGTGGACATCAAATGC
TGAAATATGTTTCAACATCTGAATCAGATGGTACAGATTGCTGCAGTGGAAAATCAGGTGAAGAAGAAAA
CATTTTCTCGAAAGAATCATTCAAACTTATGGAAACTCAACAAGAAGAGGAAACAGAGAAGAAAGACAGC
AGAAAATTATTTCAGGAAGGTGATAAGTGGCTAACAGAAGAGGCACAGAGTGAACAGCAAACAAATATTG
AACAGGAAGTATCACTGGACCTGATTTTAGTAGAAGAGTATGACTCATTAATAGAAAAGATGAGCAACTG
GAATTTTCCAATTTTTGAACTTGTAGAAAAGATGGGAGAGAAATCAGGAAGGATTCTCAGTCAGGTTATG
TATACCTTATTTCAAGACACTGGTTTATTGGAAATATTTAAAATTCCCACTCAACAATTTATGAACTATT
TTCGTGCATTAGAAAATGGCTATCGAGACATTCCTTATCACAATCGTATACATGCCACAGATGTGCTACA
TGCAGTTTGGTATCTGACAACACGGCCAGTTCCTGGCTTACAGCAGATCCACAATGGTTGTGGAACAGGA
AATGAAACAGATTCTGATGGTAGAATTAACCATGGGCGAATTGCTTATATTTCTTCGAAGAGCTGCTCTA
ATCCTGATGAGAGTTATGGCTGCCTGTCTTCAAACATTCCTGCATTAGAATTGATGGCTCTATACGTGGC
AGCTGCCATGCATGATTATGATCACCCAGGGAGGACAAATGCATTTCTAGTGGCTACAAATGCCCCTCAG
GCAGTTTTATACAATGACAGATCTGTTCTGGAAAATCATCATGCTGCGTCAGCTTGGAATCTATATCTTT
CTCGCCCAGAATACAACTTCCTTCTTCATCTTGATCATGTGGAATTCAAGCGCTTTCGTTTTTTAGTCAT
TGAAGCAATCCTTGCTACGGATCTTAAAAAGCATTTTGATTTTCTCGCAGAATTCAATGCCAAGGCAAAT
GATGTAAATAGTAATGGCATAGAATGGAGTAATGAAAATGATCGCCTCTTGGTATGCCAGGTGTGCATCA
AACTGGCAGATATAAATGGCCCAGCAAAAGTTCGAGACTTGCATTTGAAATGGACAGAAGGCATTGTCAA
TGAATTTTATGAGCAGGGAGATGAAGAAGCAAATCTTGGTCTGCCCATCAGTCCATTCATGGATCGTTCT
TCTCCTCAACTAGCAAAACTCCAAGAATCTTTTATCACCCACATAGTGGGTCCCCTGTGTAACTCCTATG
ATGCTGCTGGTTTGCTACCAGGTCAGTGGTTAGAAGCAGAAGAGGATAATGATACTGAAAGTGGTGATGA
TGAAGACGGTGAAGAATTAGATACAGAAGATGAAGAAATGGAAAACAATCTAAATCCAAAACCACCAAGA
AGGAAAAGCAGACGGCGAATATTTTGTCAGCTAATGCACCACCTCACTGAAAACCACAAGATATGGAAGG
AAATCGTAGAGGAAGAAGAAAAATGTAAAGCTGATGGGAATAAACTGCAGGTGGAGAATTCCTCCTTACC
TCAAGCAGATGAGATTCAGGTAATTGAAGAGGCAGATGAAGAGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219619 representing NM_000922
Red=Cloning site Green=Tags(s)

MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPR
RCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTK
RGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTL
AHPLRLRHCVLVLLLASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSS
AAEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNG
VDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPK
QRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPN
TPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDS
RKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVM
YTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTG
NETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKAN
DVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRS
SPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPR
RKSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000922
ORF Size 3336 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000922.4
RefSeq Size 4784 bp
RefSeq ORF 3339 bp
Locus ID 5140
UniProt ID Q13370
Cytogenetics 11p15.2
Domains PDEase, HDc
Protein Families Druggable Genome, Transmembrane
Protein Pathways Insulin signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism
MW 124.2 kDa
Gene Summary Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. May play a role in fat metabolism. Regulates cAMP binding of RAPGEF3. Through simultaneous binding to RAPGEF3 and PIK3R6 assembles a signaling complex in which the PI3K gamma complex is activated by RAPGEF3 and which is involved in angiogenesis.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.