A2ML1 (NM_144670) Human Tagged ORF Clone

CAT#: RC219615

Reviews ()
Write a review

A2ML1 (Myc-DDK-tagged)-Human alpha-2-macroglobulin-like 1 (A2ML1)



  "NM_144670" in other vectors (6)

USD 1,140.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name A2ML1 (NM_144670) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol A2ML1
Synonyms CPAMD9; OMS; p170
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC219615 representing NM_144670
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGCTCAGCTCCTTCTAGGAATGTTGGCCCTATCACCAGCCATTGCAGAAGAACTTCCAAACTACC
TGGTGACATTACCAGCCCGGCTAAATTTCCCCTCCGTTCAGAAGGTTTGTTTGGACCTGAGCCCTGGGTA
CAGTGATGTTAAATTCACGGTTACTCTGGAGACCAAGGACAAGACCCAGAAGTTGCTAGAATACTCTGGA
CTGAAGAAGAGGCACTTACATTGTATCTCCTTTCTTGTACCACCTCCTGCTGGTGGCACAGAAGAAGTGG
CCACAATCCGGGTGTCGGGAGTTGGAAATAACATCAGCTTTGAGGAGAAGAAAAAGGTTCTAATTCAGAG
GCAGGGGAACGGCACCTTTGTACAGACTGACAAACCTCTCTACACCCCAGGGCAGCAAGTGTATTTCCGC
ATTGTCACCATGGATAGCAACTTCGTTCCAGTGAATGACAAGTACTCCATGGTGGAACTACAGGATCCAA
ATAGCAACAGGATTGCACAGTGGCTGGAAGTGGTACCTGAGCAAGGCATTGTAGACCTGTCCTTCCAACT
GGCACCAGAGGCAATGCTGGGCACCTACACTGTGGCAGTGGCTGAGGGCAAGACCTTTGGTACTTTCAGT
GTGGAGGAATATGTGCTGCCGAAGTTTAAGGTGGAAGTGGTGGAACCCAAGGAGTTATCAACGGTGCAGG
AATCTTTCTTAGTAAAAATTTGTTGTAGGTACACCTATGGAAAGCCCATGCTAGGGGCAGTGCAGGTATC
TGTGTGTCAGAAGGCAAATACTTACTGGTATCGAGAGGTGGAACGGGAACAGCTTCCTGACAAATGCAGG
AACCTCTCTGGACAGACTGACAAAACAGGATGTTTCTCAGCACCTGTGGACATGGCCACCTTTGACCTCA
TTGGATATGCGTACAGCCATCAAATCAATATTGTGGCTACTGTTGTGGAGGAAGGGACAGGTGTGGAGGC
CAATGCCACTCAGAATATCTACATTTCTCCACAAATGGGATCAATGACCTTTGAAGACACCAGCAATTTT
TACCATCCAAATTTCCCCTTCAGTGGGAAGATAAGAGTTAGGGGCCATGATGACTCCTTCCTCAAGAACC
ATCTAGTGTTTCTGGTGATTTATGGCACAAATGGAACCTTCAACCAGACCCTGGTTACTGATAACAATGG
CCTAGCTCCCTTTACCTTGGAGACATCCGGTTGGAATGGGACAGACGTTTCTCTGGAGGGAAAGTTTCAA
ATGGAAGACTTAGTATATAATCCGGAACAAGTGCCACGTTACTACCAAAATGCCTACCTGCACCTGCGAC
CCTTCTACAGCACAACCCGCAGCTTCCTTGGCATCCACCGGCTAAACGGCCCCTTGAAATGTGGCCAGCC
CCAGGAAGTGCTGGTGGATTATTACATCGACCCGGCCGATGCAAGCCCTGACCAAGAGATCAGCTTCTCC
TACTATTTAATAGGGAAAGGAAGTTTGGTGATGGAGGGGCAGAAACACCTGAACTCTAAGAAGAAAGGAC
TGAAAGCCTCCTTCTCTCTCTCACTGACCTTCACTTCGAGACTGGCCCCTGATCCTTCCCTGGTGATCTA
TGCCATTTTTCCCAGTGGAGGTGTTGTAGCTGACAAAATTCAGTTCTCAGTCGAGATGTGCTTTGACAAT
CAGGTTTCCCTTGGCTTCTCCCCCTCCCAGCAGCTTCCAGGAGCAGAAGTGGAGCTGCAGCTGCAGGCAG
CTCCCGGATCCCTGTGTGCGCTCCGGGCGGTGGATGAGAGTGTCTTACTGCTTAGGCCAGACAGAGAGCT
GAGCAACCGCTCTGTCTATGGGATGTTTCCATTCTGGTATGGTCACTACCCCTATCAAGTGGCTGAGTAT
GATCAGTGTCCAGTGTCTGGCCCATGGGACTTTCCTCAGCCCCTCATTGACCCAATGCCCCAAGGGCATT
CGAGCCAGCGTTCCATTATCTGGAGGCCCTCGTTCTCTGAAGGCACGGACCTTTTCAGCTTTTTCCGGGA
CGTGGGCCTGAAAATACTGTCCAATGCCAAAATCAAGAAGCCAGTAGATTGCAGTCACAGATCTCCAGAA
TACAGCACTGCTATGGGTGCAGGCGGTGGTCATCCAGAGGCTTTTGAGTCATCAACTCCTTTACATCAAG
CAGAGGATTCTCAGGTCCGCCAGTACTTCCCAGAGACCTGGCTCTGGGATCTGTTTCCTATTGGTAACTC
GGGGAAGGAGGCGGTCCACGTCACAGTTCCTGACGCCATCACCGAGTGGAAGGCGATGAGTTTCTGCACT
TCCCAGTCAAGAGGCTTCGGGCTTTCACCCACTGTTGGACTAACTGCTTTCAAGCCGTTCTTTGTTGACC
TGACTCTCCCTTACTCAGTAGTCCGTGGGGAATCCTTTCGTCTTACTGCCACCATCTTCAATTACCTAAA
GGATTGCATCAGGGTTCAGACTGACCTGGCTAAATCGCATGAGTACCAGCTAGAATCATGGGCAGATTCT
CAGACCTCCAGTTGTCTCTGTGCTGATGAAGCAAAAACCCACCACTGGAACATCACAGCTGTCAAATTGG
GTCACATTAACTTTACTATTAGTACAAAGATTCTGGACAGCAATGAACCATGTGGGGGCCAGAAGGGGTT
TGTTCCCCAAAAGGGCCGAAGTGACACGCTCATCAAGCCAGTTCTCGTCAAACCTGAGGGAGTCCTGGTG
GAGAAGACACACAGCTCATTGCTGTGCCCAAAAGGAAAGGTGGCATCTGAATCTGTCTCCCTGGAGCTCC
CAGTGGACATTGTTCCTGACTCGACCAAGGCTTATGTTACGGTTCTGGGAGACATTATGGGCACAGCCCT
GCAGAACCTGGATGGTCTGGTGCAGATGCCCAGTGGCTGTGGCGAGCAGAACATGGTCTTGTTTGCTCCC
ATCATCTATGTCTTGCAGTACCTGGAGAAGGCAGGGCTGCTGACGGAGGAGATCAGGTCTCGGGCAGTGG
GTTTCCTGGAAATAGGGTACCAGAAGGAGCTGATGTACAAACACAGCAATGGCTCATACAGTGCCTTTGG
GGAGCGAGATGGAAATGGAAACACATGGCTGACAGCGTTTGTCACAAAATGCTTTGGCCAAGCTCAGAAA
TTCATCTTCATTGATCCCAAGAACATCCAGGATGCTCTCAAGTGGATGGCAGGAAACCAGCTCCCCAGTG
GCTGCTATGCCAACGTGGGAAATCTCCTTCACACAGCTATGAAGGGTGGTGTTGATGATGAGGTCTCCTT
GACTGCGTATGTCACAGCTGCATTGCTGGAGATGGGAAAGGATGTAGATGACCCAATGGTGAGTCAGGGT
CTACGGTGTCTCAAGAATTCGGCCACCTCCACGACCAACCTCTACACACAGGCCCTGTTGGCTTACATTT
TCTCCCTGGCTGGGGAAATGGACATCAGAAACATTCTCCTTAAACAGTTAGATCAACAGGCTATCATCTC
AGGAGAATCCATTTACTGGAGCCAGAAACCTACTCCATCATCGAACGCCAGCCCTTGGTCTGAGCCTGCG
GCTGTAGATGTGGAACTCACAGCATATGCATTGTTGGCCCAGCTTACCAAGCCCAGCCTGACTCAAAAGG
AGATAGCGAAGGCCACTAGCATAGTGGCTTGGTTGGCCAAGCAACGCAATGCATATGGGGGCTTCTCTTC
TACTCAGGATACTGTAGTTGCTCTCCAAGCTCTTGCCAAATATGCCACTACCGCCTACATGCCATCTGAG
GAGATCAACCTGGTTGTAAAATCCACTGAGAATTTCCAGCGCACATTCAACATACAGTCAGTTAACAGAT
TGGTATTTCAGCAGGATACCCTGCCCAATGTCCCTGGAATGTACACGTTGGAGGCCTCAGGCCAGGGCTG
TGTCTATGTGCAGACGGTGTTGAGATACAATATTCTCCCTCCCACAAATATGAAGACCTTTAGTCTTAGT
GTGGAAATAGGAAAAGCTAGATGTGAGCAACCGACTTCACCTCGATCCTTGACTCTCACTATTCACACCA
GTTATGTGGGGAGCCGTAGCTCTTCCAATATGGCTATTGTGGAAGTGAAGATGCTATCTGGGTTCAGTCC
CATGGAGGGCACCAATCAGTTACTTCTCCAGCAACCCCTGGTGAAGAAGGTTGAATTTGGAACTGACACA
CTTAACATTTACTTGGATGAGCTCATTAAGAACACTCAGACTTACACCTTCACCATCAGCCAAAGTGTGC
TGGTCACCAACTTGAAACCAGCAACCATCAAGGTCTATGACTACTACCTACCAGATGAACAGGCAACAAT
TCAGTATTCTGATCCCTGTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219615 representing NM_144670
Red=Cloning site Green=Tags(s)

MWAQLLLGMLALSPAIAEELPNYLVTLPARLNFPSVQKVCLDLSPGYSDVKFTVTLETKDKTQKLLEYSG
LKKRHLHCISFLVPPPAGGTEEVATIRVSGVGNNISFEEKKKVLIQRQGNGTFVQTDKPLYTPGQQVYFR
IVTMDSNFVPVNDKYSMVELQDPNSNRIAQWLEVVPEQGIVDLSFQLAPEAMLGTYTVAVAEGKTFGTFS
VEEYVLPKFKVEVVEPKELSTVQESFLVKICCRYTYGKPMLGAVQVSVCQKANTYWYREVEREQLPDKCR
NLSGQTDKTGCFSAPVDMATFDLIGYAYSHQINIVATVVEEGTGVEANATQNIYISPQMGSMTFEDTSNF
YHPNFPFSGKIRVRGHDDSFLKNHLVFLVIYGTNGTFNQTLVTDNNGLAPFTLETSGWNGTDVSLEGKFQ
MEDLVYNPEQVPRYYQNAYLHLRPFYSTTRSFLGIHRLNGPLKCGQPQEVLVDYYIDPADASPDQEISFS
YYLIGKGSLVMEGQKHLNSKKKGLKASFSLSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDN
QVSLGFSPSQQLPGAEVELQLQAAPGSLCALRAVDESVLLLRPDRELSNRSVYGMFPFWYGHYPYQVAEY
DQCPVSGPWDFPQPLIDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAKIKKPVDCSHRSPE
YSTAMGAGGGHPEAFESSTPLHQAEDSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCT
SQSRGFGLSPTVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDCIRVQTDLAKSHEYQLESWADS
QTSSCLCADEAKTHHWNITAVKLGHINFTISTKILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLV
EKTHSSLLCPKGKVASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNLDGLVQMPSGCGEQNMVLFAP
IIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAFVTKCFGQAQK
FIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVDDEVSLTAYVTAALLEMGKDVDDPMVSQG
LRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGESIYWSQKPTPSSNASPWSEPA
AVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQRNAYGGFSSTQDTVVALQALAKYATTAYMPSE
EINLVVKSTENFQRTFNIQSVNRLVFQQDTLPNVPGMYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLS
VEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDT
LNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_144670
ORF Size 4362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_144670.2, NM_144670.3, NM_144670.4, NM_144670.5, NP_653271.2
RefSeq Size 5123 bp
RefSeq ORF 4365 bp
Locus ID 144568
Cytogenetics 12p13.31
MW 161 kDa
Gene Summary This gene encodes a member of the alpha-macroglobulin superfamily. The encoded protein is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus (PNP; PMID:20805888). Mutations in these gene have also been associated with some cases of Noonan syndrome (NS; PMID:24939586) as well as some cases of otitis media (PMID:26121085). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]

Citations (1)

Other Versions

Other products for "A2ML1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit monoclonal anti-A2ML1 antibody for SISCAPA, clone OTIR2E11
    • 100 ul

USD 428.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools