BD2(DEFB4A) (NM_004942) Human Tagged ORF Clone

CAT#: RC219487

DEFB4A (Myc-DDK-tagged)-Human defensin, beta 4A (DEFB4A)

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 3 publications.

Product images

Specifications

Product Data
Product Name BD2(DEFB4A) (NM_004942) Human Tagged ORF Clone
Symbol DEFB4A
Synonyms BD-2; DEFB-2; DEFB102; DEFB2; DEFB4; HBD-2; SAP1
Vector pCMV6-Entry
Sequence Data
>RC219487 representing NM_004942
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGTCTTGTATCTCCTCTTCTCGTTCCTCTTCATATTCCTGATGCCTCTTCCAGGTGTTTTTGGTG
GTATAGGCGATCCTGTTACCTGCCTTAAGAGTGGAGCCATATGTCATCCAGTCTTTTGCCCTAGAAGGTA
TAAACAAATTGGCACCTGTGGTCTCCCTGGAACAAAATGCTGCAAAAAGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219487 representing NM_004942
Red=Cloning site Green=Tags(s)

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004942
ORF Size 192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004942.1, NM_004942.2, NM_004942.3, NP_004933
RefSeq Size 336
RefSeq ORF 195
Locus ID 1673
Cytogenetics 8p23.1
Protein Families Secreted Protein, Transmembrane, Druggable Genome
MW 7.04 kDa
Gene Summary Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)