GABA B Receptor 2(GABBR2) (NM_005458) Human Tagged ORF Clone

CAT#: RC219404

GABBR2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) B receptor, 2 (GABBR2)

Clone Modification / Custom Cloning Service

USD 1,442.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GABA B Receptor 2(GABBR2) (NM_005458) Human Tagged ORF Clone
Symbol GABBR2
Synonyms GABABR2; GPR51; GPRC3B; HG20; HRIHFB2099
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC219404 representing NM_005458
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCCCCGCGGAGCTCCGGGCAGCCCGGGCCGCCGCCGCCGCCGCCACCGCCGCCCGCGCGCCTGC
TACTGCTACTGCTGCTGCCGCTGCTGCTGCCTCTGGCGCCCGGGGCCTGGGGCTGGGCGCGGGGCGCCCC
CCGGCCGCCGCCCAGCAGCCCGCCGCTCTCCATCATGGGCCTCATGCCGCTCACCAAGGAGGTGGCCAAG
GGCAGCATCGGGCGCGGTGTGCTCCCCGCCGTGGAACTGGCCATCGAGCAGATCCGCAACGAGTCACTCC
TGCGCCCCTACTTCCTCGACCTGCGGCTCTATGACACGGAGTGCGACAACGCAAAAGGGTTGAAAGCCTT
CTACGATGCAATAAAATACGGGCCGAACCACTTGATGGTGTTTGGAGGCGTCTGTCCATCCGTCACATCC
ATCATTGCAGAGTCCCTCCAAGGCTGGAATCTGGTGCAGCTTTCTTTTGCTGCAACCACGCCTGTTCTAG
CCGATAAGAAAAAATACCCTTATTTCTTTCGGACCGTCCCATCAGACAATGCGGTGAATCCAGCCATTCT
GAAGTTGCTCAAGCACTACCAGTGGAAGCGCGTGGGCACGCTGACGCAAGACGTTCAGAGGTTCTCTGAG
GTGCGGAATGACCTGACTGGAGTTCTGTATGGCGAGGACATTGAGATTTCAGACACCGAGAGCTTCTCCA
ACGATCCCTGTACCAGTGTCAAAAAGCTGAAGGGGAATGATGTGCGGATCATCCTTGGCCAGTTTGACCA
GAATATGGCAGCAAAAGTGTTCTGTTGTGCATACGAGGAGAACATGTATGGTAGTAAATATCAGTGGATC
ATTCCGGGCTGGTACGAGCCTTCTTGGTGGGAGCAGGTGCACACGGAAGCCAACTCATCCCGCTGCCTCC
GGAAGAATCTGCTTGCTGCCATGGAGGGCTACATTGGCGTGGATTTCGAGCCCCTGAGCTCCAAGCAGAT
CAAGACCATCTCAGGAAAGACTCCACAGCAGTATGAGAGAGAGTACAACAACAAGCGGTCAGGCGTGGGG
CCCAGCAAGTTCCACGGGTACGCCTACGATGGCATCTGGGTCATCGCCAAGACACTGCAGAGGGCCATGG
AGACACTGCATGCCAGCAGCCGGCACCAGCGGATCCAGGACTTCAACTACACGGACCACACGCTGGGCAG
GATCATCCTCAATGCCATGAACGAGACCAACTTCTTCGGGGTCACGGGTCAAGTTGTATTCCGGAATGGG
GAGAGAATGGGGACCATTAAATTTACTCAATTTCAAGACAGCAGGGAGGTGAAGGTGGGAGAGTACAACG
CTGTGGCCGACACACTGGAGATCATCAATGACACCATCAGGTTCCAAGGATCCGAACCACCAAAAGACAA
GACCATCATCCTGGAGCAGCTGCGGAAGATCTCCCTACCTCTCTACAGCATCCTCTCTGCCCTCACCATC
CTCGGGATGATCATGGCCAGTGCTTTTCTCTTCTTCAACATCAAGAACCGGAATCAGAAGCTCATAAAGA
TGTCGAGTCCATACATGAACAACCTTATCATCCTTGGAGGGATGCTCTCCTATGCTTCCATATTTCTCTT
TGGCCTTGATGGATCCTTTGTCTCTGAAAAGACCTTTGAAACACTTTGCACCGTCAGGACCTGGATTCTC
ACCGTGGGCTACACGACCGCTTTTGGGGCCATGTTTGCAAAGACCTGGAGAGTCCACGCCATCTTCAAAA
ATGTGAAAATGAAGAAGAAGATCATCAAGGACCAGAAACTGCTTGTGATCGTGGGGGGCATGCTGCTGAT
CGACCTGTGTATCCTGATCTGCTGGCAGGCTGTGGACCCCCTGCGAAGGACAGTGGAGAAGTACAGCATG
GAGCCGGACCCAGCAGGACGGGATATCTCCATCCGCCCTCTCCTGGAGCACTGTGAGAACACCCATATGA
CCATCTGGCTTGGCATCGTCTATGCCTACAAGGGACTTCTCATGTTGTTCGGTTGTTTCTTAGCTTGGGA
GACCCGCAACGTCAGCATCCCCGCACTCAACGACAGCAAGTACATCGGGATGAGTGTCTACAACGTGGGG
ATCATGTGCATCATCGGGGCCGCTGTCTCCTTCCTGACCCGGGACCAGCCCAATGTGCAGTTCTGCATCG
TGGCTCTGGTCATCATCTTCTGCAGCACCATCACCCTCTGCCTGGTATTCGTGCCGAAGCTCATCACCCT
GAGAACAAACCCAGATGCAGCAACGCAGAACAGGCGATTCCAGTTCACTCAGAATCAGAAGAAAGAAGAT
TCTAAAACGTCCACCTCGGTCACCAGTGTGAACCAAGCCAGCACATCCCGCCTGGAGGGCCTACAGTCAG
AAAACCATCACCTGCGAATGAAGATCACAGAGCTGGATAAAGACTTGGAAGAGGTCACCATGCAGCTGCA
GGACACACCAGAAAAGACCACCTACATTAAACAGAACCACTACCAAGAGCTCAATGACATCCTCAACCTG
GGAAACTTCACTGAGAGCACAGATGGAGGAAAGGCCATTTTAAAAAATCACCTCGATCAAAATCCCCAGC
TACAGTGGAACACAACAGAGCCCTCTCGAACATGCAAAGATCCTATAGAAGATATAAACTCTCCAGAACA
CATCCAGCGTCGGCTGTCCCTCCAGCTCCCCATCCTCCACCACGCCTACCTCCCATCCATCGGAGGCGTG
GACGCCAGCTGTGTCAGCCCCTGCGTCAGCCCCACCGCCAGCCCCCGCCACAGACATGTGCCACCCTCCT
TCCGAGTCATGGTCTCGGGCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219404 representing NM_005458
Red=Cloning site Green=Tags(s)

MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMGLMPLTKEVAK
GSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTS
IIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSE
VRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWI
IPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVG
PSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTI
LGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWIL
TVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSM
EPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVG
IMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKED
SKTSTSVTSVNQASTSRLEGLQSENHHLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGV
DASCVSPCVSPTASPRHRHVPPSFRVMVSGL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005458
ORF Size 2823 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005458.1, NM_005458.2, NM_005458.3, NM_005458.4, NM_005458.5, NM_005458.6, NM_005458.7, NP_005449
RefSeq Size 5786
RefSeq ORF 2826
Locus ID 9568
Cytogenetics 9q22.33
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 105.8 kDa
Gene Summary The multi-pass membrane protein encoded by this gene belongs to the G-protein coupled receptor 3 family and GABA-B receptor subfamily. The GABA-B receptors inhibit neuronal activity through G protein-coupled second-messenger systems, which regulate the release of neurotransmitters, and the activity of ion channels and adenylyl cyclase. This receptor subunit forms an active heterodimeric complex with GABA-B receptor subunit 1, neither of which is effective on its own. Allelic variants of this gene have been associated with nicotine dependence.[provided by RefSeq, Jan 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)