Xanthine Oxidase (XDH) (NM_000379) Human Tagged ORF Clone

CAT#: RC219402

Reviews ()
Write a review

XDH (Myc-DDK-tagged)-Human xanthine dehydrogenase (XDH)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,587.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol XDH
Synonyms XAN1; XO; XOR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219402 representing NM_000379
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGCAGACAAATTGGTTTTCTTTGTGAATGGCAGAAAGGTGGTGGAGAAAAATGCAGATCCAGAGA
CAACCCTTTTGGCCTACCTGAGAAGAAAGTTGGGGCTGAGTGGAACCAAGCTCGGCTGTGGAGAGGGGGG
CTGCGGGGCTTGCACAGTGATGCTCTCCAAGTATGATCGTCTGCAGAACAAGATCGTCCACTTTTCTGCC
AATGCCTGCCTGGCCCCCATCTGCTCCTTGCACCATGTTGCAGTGACAACTGTGGAAGGAATAGGAAGCA
CCAAGACGAGGCTGCATCCTGTGCAGGAGAGAATTGCCAAAAGCCACGGCTCCCAGTGCGGGTTCTGCAC
CCCTGGCATCGTCATGAGTATGTACACACTGCTCCGGAATCAGCCCGAGCCCACCATGGAGGAGATTGAG
AATGCCTTCCAAGGAAATCTGTGCCGCTGCACAGGCTACAGACCCATCCTCCAGGGCTTCCGGACCTTTG
CCAGGGATGGTGGATGCTGTGGAGGAGATGGGAATAATCCAAATTGCTGCATGAACCAGAAGAAAGACCA
CTCAGTCAGCCTCTCGCCATCTTTATTCAAACCAGAGGAGTTCACGCCCCTGGATCCAACCCAGGAGCCC
ATTTTTCCCCCAGAGTTGCTGAGGCTGAAAGACACTCCTCGGAAGCAGCTGCGATTTGAAGGGGAGCGTG
TGACGTGGATACAGGCCTCAACCCTCAAGGAGCTGCTGGACCTCAAGGCTCAGCACCCTGACGCCAAGCT
GGTCGTGGGGAACACGGAGATTGGCATTGAGATGAAGTTCAAGAATATGCTGTTTCCTATGATTGTCTGC
CCAGCCTGGATCCCTGAGCTGAATTCGGTAGAACATGGACCCGACGGTATCTCCTTTGGAGCTGCTTGCC
CCCTGAGCATTGTGGAAAAAACCCTGGTGGATGCTGTTGCTAAGCTTCCTGCCCAAAAGACAGAGGTGTT
CAGAGGGGTCCTGGAGCAGCTGCGCTGGTTTGCTGGGAAGCAAGTCAAGTCTGTGGCGTCCGTTGGAGGG
AACATCATCACTGCCAGCCCCATCTCCGACCTCAACCCCGTGTTCATGGCCAGTGGGGCCAAGCTGACAC
TTGTGTCCAGAGGCACCAGGAGAACTGTCCAGATGGACCACACCTTCTTCCCTGGCTACAGAAAGACCCT
GCTGAGCCCGGAGGAGATACTGCTCTCCATAGAGATCCCCTACAGCAGGGAGGGGGAGTATTTCTCAGCA
TTCAAGCAGGCCTCCCGGAGAGAAGATGACATTGCCAAGGTAACCAGTGGCATGAGAGTTTTATTCAAGC
CAGGAACCACAGAGGTACAGGAGCTGGCCCTTTGCTATGGTGGAATGGCCAACAGAACCATCTCAGCCCT
CAAGACCACTCAGAGGCAGCTTTCCAAGCTCTGGAAGGAGGAGCTGCTGCAGGACGTGTGTGCAGGACTG
GCAGAGGAGCTGCATCTGCCTCCCGATGCCCCTGGTGGCATGGTGGACTTCCGGTGCACCCTCACCCTCA
GCTTCTTCTTCAAGTTCTACCTGACAGTCCTTCAGAAGCTGGGCCAAGAGAACCTGGAAGACAAGTGTGG
TAAACTGGACCCCACTTTCGCCAGTGCAACTTTACTGTTTCAGAAAGACCCCCCAGCCGATGTCCAGCTC
TTCCAAGAGGTGCCCAAGGGTCAGTCTGAGGAGGACATGGTGGGCCGGCCCCTGCCCCACCTGGCAGCGG
ACATGCAGGCCTCTGGTGAGGCCGTGTACTGTGACGACATTCCTCGCTACGAGAATGAGCTGTCTCTCCG
GCTGGTCACCAGCACCCGGGCCCACGCCAAGATCAAGTCCATAGATACATCAGAAGCTAAGAAGGTTCCA
GGGTTTGTTTGTTTCATTTCCGCTGATGATGTTCCTGGGAGTAACATAACTGGAATTTGTAATGATGAGA
CAGTCTTTGCGAAGGATAAGGTTACTTGTGTTGGGCATATCATTGGTGCTGTGGTTGCTGACACCCCGGA
ACACACACAGAGAGCTGCCCAAGGGGTGAAAATCACCTATGAAGAACTACCAGCCATTATCACAATTGAG
GATGCTATAAAGAACAACTCCTTTTATGGACCTGAGCTGAAGATCGAGAAAGGGGACCTAAAGAAGGGGT
TTTCCGAAGCAGATAATGTTGTGTCAGGGGAGATATACATCGGTGGCCAAGAGCACTTCTACCTGGAGAC
TCACTGCACCATTGCTGTTCCAAAAGGCGAGGCAGGGGAGATGGAGCTCTTTGTGTCTACACAGAACACC
ATGAAGACCCAGAGCTTTGTTGCAAAAATGTTGGGGGTTCCAGCAAACCGGATTGTGGTTCGAGTGAAGA
GAATGGGAGGAGGCTTTGGAGGCAAGGAGACCCGGAGCACTGTGGTGTCCACGGCAGTGGCCCTGGCTGC
ATATAAGACCGGCCGCCCTGTGCGATGCATGCTGGACCGTGATGAGGACATGCTGATAACTGGTGGCAGA
CATCCCTTCCTGGCCAGATACAAGGTTGGCTTCATGAAGACTGGGACAGTTGTGGCTCTTGAGGTGGACC
ACTTCAGCAATGTGGGGAACACCCAGGATCTCTCTCAGAGTATTATGGAACGAGCTTTATTCCACATGGA
CAACTGCTATAAAATCCCCAACATCCGGGGCACTGGGCGGCTGTGCAAAACCAACCTTCCCTCCAACACG
GCCTTCCGGGGCTTTGGGGGGCCCCAGGGGATGCTCATTGCCGAGTGCTGGATGAGTGAAGTTGCAGTGA
CCTGTGGGATGCCTGCAGAGGAGGTGCGGAGAAAAAACCTGTACAAAGAAGGGGACCTGACACACTTCAA
CCAGAAGCTTGAGGGTTTCACCTTGCCCAGATGCTGGGAAGAATGCCTAGCAAGCTCTCAGTATCATGCT
CGGAAGAGTGAGGTTGACAAGTTCAACAAGGAGAATTGTTGGAAAAAGAGAGGATTGTGCATAATTCCCA
CCAAGTTTGGAATAAGCTTCACAGTTCCTTTTCTGAATCAGGCAGGAGCCCTACTTCATGTGTACACAGA
TGGCTCTGTGCTGCTGACCCACGGGGGGACTGAGATGGGCCAAGGCCTTCATACCAAAATGGTCCAGGTG
GCCAGTAGAGCTCTGAAAATCCCCACCTCTAAGATTTATATCAGCGAGACAAGCACTAACACTGTGCCCA
ACACCTCTCCCACGGCTGCCTCTGTCAGCGCTGACCTCAATGGACAGGCCGTCTATGCGGCTTGTCAGAC
CATCTTGAAAAGGCTGGAACCCTACAAGAAGAAGAATCCCAGTGGCTCCTGGGAAGACTGGGTCACAGCT
GCCTACATGGACACAGTGAGCTTGTCTGCCACTGGGTTTTATAGAACACCCAATCTGGGCTACAGCTTTG
AGACTAACTCAGGGAACCCCTTCCACTACTTCAGCTATGGGGTGGCTTGCTCTGAAGTAGAAATCGACTG
CCTAACAGGAGATCATAAGAACCTCCGCACAGATATTGTCATGGATGTTGGCTCCAGTCTAAACCCTGCT
ATTGATATTGGACAGGTGGAAGGGGCATTTGTCCAGGGCCTTGGCCTCTTCACCCTAGAGGAGCTACACT
ATTCCCCCGAGGGGAGCCTGCACACCCGTGGCCCTAGCACCTACAAGATCCCGGCATTTGGCAGCATCCC
CATTGAGTTCAGGGTGTCCCTGCTCCGCGACTGCCCCAACAAGAAGGCCATCTATGCATCGAAGGCTGTT
GGAGAGCCGCCCCTCTTCCTGGCTGCTTCTATCTTCTTTGCCATCAAAGATGCCATCCGTGCAGCTCGAG
CTCAGCACACAGGTAATAACGTGAAGGAACTCTTCCGGCTAGACAGCCCTGCCACCCCGGAGAAGATCCG
CAATGCCTGCGTGGACAAGTTCACCACCCTGTGTGTCACTGGTGTCCCAGAAAACTGCAAACCCTGGTCT
GTGAGGGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219402 representing NM_000379
Red=Cloning site Green=Tags(s)

MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDRLQNKIVHFSA
NACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTMEEIE
NAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCCMNQKKDHSVSLSPSLFKPEEFTPLDPTQEP
IFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVC
PAWIPELNSVEHGPDGISFGAACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGG
NIITASPISDLNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKEELLQDVCAGL
AEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLDPTFASATLLFQKDPPADVQL
FQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAKIKSIDTSEAKKVP
GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIE
DAIKNNSFYGPELKIEKGDLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNT
MKTQSFVAKMLGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGRLCKTNLPSNT
AFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKLEGFTLPRCWEECLASSQYHA
RKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQV
ASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTA
AYMDTVSLSATGFYRTPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPA
IDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWS
VRV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000379
ORF Size 3999 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000379.4
RefSeq Size 4428 bp
RefSeq ORF 4002 bp
Locus ID 7498
UniProt ID P47989
Cytogenetics 2p23.1
Protein Families Druggable Genome
Protein Pathways Caffeine metabolism, Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism
MW 146.2 kDa
Gene Summary Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism. [provided by RefSeq, Jan 2014]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.