BCL9 (NM_004326) Human Tagged ORF Clone

CAT#: RC219304

Reviews ()
Write a review
  • TrueORF®

BCL9 (Myc-DDK-tagged)-Human B-cell CLL/lymphoma 9 (BCL9)



  "NM_004326" in other vectors (6)

USD 1,140.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BCL9 (NM_004326) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BCL9
Synonyms LGS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC219304 representing NM_004326
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATTCCAGTAACCCTAAAGTGAGGAGCTCTCCATCAGGAAACACACAGAGTAGCCCTAAGTCAAAGC
AGGAGGTGATGGTCCGTCCCCCTACAGTGATGTCCCCATCTGGAAACCCCCAGCTGGATTCCAAATTCTC
CAATCAGGGTAAACAGGGGGGCTCAGCCAGCCAATCCCAGCCATCCCCCTGTGACTCCAAGAGTGGGGGC
CATACCCCTAAAGCACTCCCTGGCCCAGGTGGGAGCATGGGGCTGAAGAATGGGGCTGGAAATGGTGCCA
AGGGCAAGGGGAAAAGGGAGCGAAGTATTTCCGCCGACTCCTTTGATCAGAGAGATCCTGGGACTCCAAA
CGATGACTCTGACATTAAAGAATGTAATTCTGCTGACCACATAAAGTCCCAGGATTCCCAGCACACACCA
CACTCGATGACCCCATCAAATGCTACAGCCCCCAGGTCTTCTACCCCCTCCCATGGCCAAACTACTGCCA
CAGAGCCCACACCTGCTCAGAAGACTCCAGCCAAAGTGGTGTACGTGTTTTCTACTGAGATGGCCAATAA
AGCTGCAGAAGCTGTTTTGAAGGGCCAGGTTGAAACTATCGTCTCTTTCCACATCCAGAACATTTCTAAC
AACAAGACAGAGAGAAGCACAGCGCCTCTGAACACACAGATATCTGCCCTTCGGAATGATCCGAAACCTC
TCCCACAACAGCCCCCAGCTCCGGCCAACCAGGACCAGAATTCTTCCCAGAATACCAGACTGCAGCCAAC
TCCACCCATTCCGGCACCAGCACCCAAGCCTGCCGCACCCCCACGTCCCCTGGACCGGGAGAGTCCTGGG
GTAGAAAACAAACTGATTCCTTCTGTAGGAAGTCCTGCCAGCTCCACTCCACTGCCCCCAGATGGTACTG
GGCCCAACTCAACTCCCAACAATAGGGCAGTGACCCCTGTCTCCCAGGGGAGCAATAGCTCTTCAGCAGA
TCCCAAAGCCCCTCCGCCTCCACCAGTGTCCAGTGGCGAGCCCCCCACACTGGGAGAGAATCCCGATGGC
CTATCTCAGGAGCAGCTGGAGCACCGGGAGCGCTCCTTACAAACTCTCAGAGATATCCAGCGCATGCTTT
TTCCTGATGAGAAAGAATTCACAGGAGCACAAAGTGGGGGACCGCAGCAGAATCCTGGGGTATTAGATGG
GCCTCAGAAAAAACCAGAAGGGCCAATACAGGCCATGATGGCCCAATCCCAAAGCCTAGGTAAGGGACCT
GGGCCCCGGACAGACGTGGGAGCTCCATTTGGCCCTCAAGGACATAGAGATGTACCCTTTTCTCCAGATG
AAATGGTTCCACCTTCTATGAACTCCCAGTCTGGGACCATAGGACCCGACCACCTTGACCATATGACTCC
CGAGCAGATAGCGTGGCTGAAACTGCAGCAGGAGTTTTATGAAGAGAAGAGGAGGAAGCAGGAACAAGTG
GTTGTCCAGCAGTGTTCCCTCCAGGACATGATGGTCCATCAGCACGGGCCTCGGGGAGTGGTCCGAGGAC
CCCCCCCTCCATACCAGATGACCCCTAGTGAAGGCTGGGCACCTGGGGGTACAGAGCCATTTTCTGATGG
TATCAACATGCCACATTCTCTGCCCCCGAGGGGCATGGCTCCCCACCCCAACATGCCAGGGAGCCAGATG
CGCCTCCCTGGATTTGCAGGCATGATAAACTCTGAAATGGAAGGGCCGAATGTCCCCAACCCTGCATCTA
GACCAGGTCTTTCTGGAGTCAGTTGGCCAGATGATGTGCCAAAAATCCCAGATGGTCGAAATTTTCCTCC
TGGCCAGGGCATTTTCAGCGGTCCTGGCCGAGGGGAACGCTTCCCAAACCCCCAAGGATTGTCTGAAGAG
ATGTTTCAGCAGCAGCTGGCAGAGAAACAGCTGGGTCTCCCCCCAGGGATGGCCATGGAAGGCATCAGGC
CCAGCATGGAGATGAACAGGATGATTCCAGGCTCCCAGCGCCACATGGAGCCTGGGAATAACCCCATTTT
CCCTCGAATACCAGTTGAGGGCCCTCTGAGTCCTTCTAGGGGTGACTTTCCAAAAGGAATTCCCCCACAG
ATGGGCCCTGGTCGGGAACTTGAGTTTGGGATGGTTCCTAGTGGGATGAAGGGAGATGTCAATCTAAATG
TCAACATGGGATCCAACTCTCAGATGATACCTCAGAAGATGAGAGAGGCTGGGGCGGGCCCTGAGGAGAT
GCTGAAATTACGCCCAGGTGGCTCAGACATGCTGCCTGCTCAGCAGAAGATGGTGCCACTGCCATTTGGT
GAGCACCCCCAGCAGGAGTATGGCATGGGCCCCAGACCATTCCTTCCCATGTCTCAGGGTCCAGGCAGCA
ACAGTGGCTTGCGGAATCTCAGAGAACCAATTGGGCCCGACCAGAGGACTAACAGCCGGCTCAGTCATAT
GCCACCACTACCTCTCAACCCTTCCAGTAACCCCACCAGCCTCAACACAGCTCCTCCAGTTCAGCGCGGC
CTGGGGCGGAAGCCCTTGGATATATCTGTGGCAGGCAGCCAGGTGCATTCCCCAGGCATTAACCCTCTGA
AGTCTCCCACGATGCACCAAGTCCAGTCACCAATGCTGGGCTCGCCCTCGGGGAACCTCAAGTCCCCCCA
GACTCCATCGCAGCTGGCAGGCATGCTGGCGGGCCCAGCTGCTGCTGCTTCCATTAAGTCCCCCCCTGTT
TTGGGGTCTGCTGCTGCTTCACCTGTCCACCTCAAGTCTCCATCACTTCCTGCCCCGTCACCTGGATGGA
CCTCTTCTCCAAAACCTCCCCTTCAGAGTCCTGGGATCCCTCCAAACCATAAAGCACCCCTCACCATGGC
CTCCCCAGCCATGCTGGGAAATGTAGAGTCAGGTGGCCCCCCACCTCCTACAGCCAGCCAGCCTGCCTCT
GTGAATATCCCTGGAAGTCTTCCCTCTAGTACACCTTATACCATGCCTCCAGAGCCAACCCTTTCCCAGA
ACCCACTCTCTATTATGATGTCTCGAATGTCCAAGTTTGCAATGCCCAGTTCCACCCCGTTATACCATGA
TGCTATCAAGACTGTGGCCAGCTCAGATGACGACTCCCCTCCAGCTCGTTCTCCCAACTTGCCATCAATG
AATAATATGCCAGGAATGGGCATTAATACACAGAATCCTCGAATTTCAGGTCCAAACCCCGTGGTTCCGA
TGCCAACCCTCAGCCCAATGGGAATGACCCAGCCACTTTCTCACTCCAATCAGATGCCCTCTCCAAATGC
CGTGGGACCCAACATACCTCCTCATGGGGTCCCAATGGGGCCTGGCTTGATGTCACACAATCCTATCATG
GGGCATGGGTCCCAGGAGCCACCGATGGTACCTCAAGGACGGATGGGCTTCCCCCAGGGCTTCCCTCCAG
TACAGTCTCCCCCACAGCAGGTTCCATTCCCTCACAATGGCCCCAGTGGGGGGCAGGGCAGCTTCCCAGG
AGGGATGGGTTTCCCAGGAGAAGGCCCCCTTGGCCGCCCCAGCAACCTGCCCCAAAGTTCAGCAGATGCA
GCACTTTGCAAGCCTGGAGGCCCCGGGGGTCCTGACTCCTTCACTGTCCTGGGGAACAGCATGCCTTCGG
TGTTTACAGACCCAGATCTGCAGGAGGTCATCCGACCTGGAGCCACCGGAATACCTGAGTTTGATCTATC
CCGCATTATTCCATCTGAGAAGCCCAGCCAGACGCTGCAATATTTCCCTCGAGGGGAAGTTCCAGGCCGT
AAACAGCCCCAGGGTCCTGGACCTGGGTTTTCACACATGCAGGGGATGATGGGCGAACAAGCCCCCAGAA
TGGGACTAGCATTACCTGGCATGGGAGGTCCAGGGCCAGTGGGAACTCCGGACATCCCTCTTGGTACAGC
TCCATCCATGCCAGGCCACAACCCCATGAGACCACCAGCCTTTCTCCAACAAGGCATGATGGGACCTCAC
CATCGGATGATGTCACCAGCACAATCTACAATGCCCGGCCAGCCCACCCTGATGAGCAATCCAGCTGCTG
CCGTGGGCATGATTCCTGGCAAGGATCGGGGGCCTGCCGGGCTCTACACCCACCCTGGGCCTGTGGGCTC
TCCAGGCATGATGATGTCCATGCAGGGCATGATGGGACCCCAACAGAACATCATGATCCCCCCACAGATG
AGGCCCCGGGGCATGGCTGCTGACGTGGGCATGGGTGGATTTAGCCAAGGACCTGGCAACCCAGGAAACA
TGATGTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219304 representing NM_004326
Red=Cloning site Green=Tags(s)

MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQPSPCDSKSGG
HTPKALPGPGGSMGLKNGAGNGAKGKGKRERSISADSFDQRDPGTPNDDSDIKECNSADHIKSQDSQHTP
HSMTPSNATAPRSSTPSHGQTTATEPTPAQKTPAKVVYVFSTEMANKAAEAVLKGQVETIVSFHIQNISN
NKTERSTAPLNTQISALRNDPKPLPQQPPAPANQDQNSSQNTRLQPTPPIPAPAPKPAAPPRPLDRESPG
VENKLIPSVGSPASSTPLPPDGTGPNSTPNNRAVTPVSQGSNSSSADPKAPPPPPVSSGEPPTLGENPDG
LSQEQLEHRERSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGP
GPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFYEEKRRKQEQV
VVQQCSLQDMMVHQHGPRGVVRGPPPPYQMTPSEGWAPGGTEPFSDGINMPHSLPPRGMAPHPNMPGSQM
RLPGFAGMINSEMEGPNVPNPASRPGLSGVSWPDDVPKIPDGRNFPPGQGIFSGPGRGERFPNPQGLSEE
MFQQQLAEKQLGLPPGMAMEGIRPSMEMNRMIPGSQRHMEPGNNPIFPRIPVEGPLSPSRGDFPKGIPPQ
MGPGRELEFGMVPSGMKGDVNLNVNMGSNSQMIPQKMREAGAGPEEMLKLRPGGSDMLPAQQKMVPLPFG
EHPQQEYGMGPRPFLPMSQGPGSNSGLRNLREPIGPDQRTNSRLSHMPPLPLNPSSNPTSLNTAPPVQRG
LGRKPLDISVAGSQVHSPGINPLKSPTMHQVQSPMLGSPSGNLKSPQTPSQLAGMLAGPAAAASIKSPPV
LGSAAASPVHLKSPSLPAPSPGWTSSPKPPLQSPGIPPNHKAPLTMASPAMLGNVESGGPPPPTASQPAS
VNIPGSLPSSTPYTMPPEPTLSQNPLSIMMSRMSKFAMPSSTPLYHDAIKTVASSDDDSPPARSPNLPSM
NNMPGMGINTQNPRISGPNPVVPMPTLSPMGMTQPLSHSNQMPSPNAVGPNIPPHGVPMGPGLMSHNPIM
GHGSQEPPMVPQGRMGFPQGFPPVQSPPQQVPFPHNGPSGGQGSFPGGMGFPGEGPLGRPSNLPQSSADA
ALCKPGGPGGPDSFTVLGNSMPSVFTDPDLQEVIRPGATGIPEFDLSRIIPSEKPSQTLQYFPRGEVPGR
KQPQGPGPGFSHMQGMMGEQAPRMGLALPGMGGPGPVGTPDIPLGTAPSMPGHNPMRPPAFLQQGMMGPH
HRMMSPAQSTMPGQPTLMSNPAAAVGMIPGKDRGPAGLYTHPGPVGSPGMMMSMQGMMGPQQNIMIPPQM
RPRGMAADVGMGGFSQGPGNPGNMMF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004326
ORF Size 4278 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004326.2, NM_004326.3, NP_004317.2
RefSeq Size 6278 bp
RefSeq ORF 4281 bp
Locus ID 607
Cytogenetics 1q21.2
Protein Families Druggable Genome
MW 149.1 kDa
Gene Summary BCL9 is associated with B-cell acute lymphoblastic leukemia. It may be a target of translocation in B-cell malignancies with abnormalities of 1q21. Its function is unknown. The overexpression of BCL9 may be of pathogenic significance in B-cell malignancies. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "BCL9"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools