ARK5 (NUAK1) (NM_014840) Human Tagged ORF Clone

CAT#: RC219282

Reviews ()
Write a review

NUAK1 (Myc-DDK-tagged)-Human NUAK family, SNF1-like kinase, 1 (NUAK1)



  "NM_014840" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NUAK1
Synonyms ARK5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219282 representing NM_014840
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGGGCCGCCGCGCCTGTGGCGGGGGACCGCCCCGACTTGGGGCTGGGGGCGCCGGGCTCTCCCC
GAGAGGCGGTGGCGGGGGCGACTGCAGCCCTGGAGCCCAGGAAGCCGCACGGGGTGAAGCGGCATCACCA
CAAGCACAACTTGAAGCACCGCTACGAGCTGCAGGAGACCCTGGGCAAAGGCACCTACGGCAAAGTCAAG
CGGGCCACCGAGAGGTTTTCTGGCCGAGTGGTTGCTATAAAATCCATTCGTAAGGACAAAATTAAGGATG
AACAAGACATGGTTCACATCAGACGAGAGATTGAGATCATGTCATCTCTCAACCATCCTCATATCATCAG
TATTTATGAAGTGTTTGAGAACAAAGATAAGATTGTGATCATCATGGAATATGCCAGCAAAGGGGAGCTG
TACGATTACATCAGTGAGCGGCGACGCCTCAGTGAGAGGGAGACCCGGCACTTCTTCCGGCAGATCGTCT
CTGCTGTGCACTATTGTCACAAGAACGGTGTGGTCCACCGGGACTTGAAGCTGGAAAATATACTGCTCGA
TGACAACTGCAATATTAAGATTGCTGACTTTGGGCTTTCCAACCTGTACCAGAAGGATAAGTTCTTACAA
ACGTTTTGTGGGAGTCCACTCTATGCATCTCCTGAGATTGTCAATGGGAGACCTTACCGAGGGCCAGAGG
TGGACAGCTGGGCCCTGGGTGTGTTGCTTTACACTCTTGTTTATGGAACAATGCCCTTCGATGGTTTCGA
TCACAAAAACCTCATTCGGCAAATCAGCAGCGGAGAGTACCGGGAGCCAACACAGCCCTCAGATGCTCGA
GGACTCATACGGTGGATGCTGATGGTGAACCCCGATCGCCGGGCCACTATTGAGGACATTGCCAACCACT
GGTGGGTGAACTGGGGCTATAAGAGCAGCGTGTGTGACTGTGATGCCCTCCATGACTCTGAGTCCCCACT
CCTGGCTCGGATCATTGACTGGCACCACCGTTCCACAGGGCTGCAGGCTGACACCGAAGCCAAAATGAAG
GGCCTGGCCAAACCCACGACCTCTGAGGTCATGCTAGAGCGGCAGCGGTCGCTGAAGAAATCCAAGAAAG
AGAATGACTTTGCTCAGTCTGGTCAGGATGCAGTGCCTGAAAGCCCATCCAAGTTGAGTTCTAAGAGGCC
CAAGGGGATCCTGAAGAAGCGAAGCAACAGCGAGCATCGCTCTCACAGCACTGGCTTCATTGAAGGTGTA
GTTGGTCCTGCCTTACCCTCTACTTTCAAGATGGAGCAGGACTTGTGCAGGACTGGCGTGCTCCTCCCAA
GCTCACCAGAGGCAGAGGTGCCGGGAAAACTCAGCCCCAAGCAGTCGGCCACGATGCCCAAGAAAGGCAT
CTTGAAAAAGACCCAGCAGAGAGAATCAGGTTACTACTCTTCCCCAGAGCGCAGTGAGTCTTCGGAGCTG
TTGGACAGTAATGATGTGATGGGCAGCAGCATCCCCTCCCCCAGCCCCCCGGACCCAGCCAGGGTAACCT
CCCACAGCCTCTCCTGCCGGAGGAAGGGCATCTTGAAACACAGCAGCAAATACTCAGCGGGCACCATGGA
CCCAGCCCTGGTCAGCCCTGAAATGCCCACACTGGAATCCCTGTCAGAGCCTGGTGTCCCTGCCGAGGGC
CTCTCCCGGAGCTACAGCCGCCCTTCCAGTGTCATCAGCGATGACAGCGTGCTGTCCAGCGACTCTTTTG
ACTTGCTGGATTTGCAGGAGAATCGCCCTGCCCGCCAGCGCATCCGCAGCTGCGTCTCTGCAGAAAACTT
CCTCCAGATCCAGGACTTTGAGGGGCTCCAGAACCGGCCCCGGCCCCAGTACCTGAAGCGGTACCGGAAC
CGGCTGGCAGACAGCAGCTTCTCCCTCCTCACAGACATGGATGATGTGACTCAGGTCTACAAGCAAGCGC
TGGAGATCTGCAGCAAGCTCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219282 representing NM_014840
Red=Cloning site Green=Tags(s)

MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQETLGKGTYGKVK
RATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYEVFENKDKIVIIMEYASKGEL
YDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLSNLYQKDKFLQ
TFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDAR
GLIRWMLMVNPDRRATIEDIANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMK
GLAKPTTSEVMLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYSSPERSESSEL
LDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEG
LSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRN
RLADSSFSLLTDMDDVTQVYKQALEICSKLN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014840
ORF Size 1983 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014840.2, NP_055655.1
RefSeq Size 6821 bp
RefSeq ORF 1986 bp
Locus ID 9891
UniProt ID O60285
Cytogenetics 12q23.3
Domains pkinase, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
MW 74.1 kDa
Gene Summary Serine/threonine-protein kinase involved in various processes such as cell adhesion, regulation of cell ploidy and senescence, cell proliferation and tumor progression. Phosphorylates ATM, CASP6, LATS1, PPP1R12A and p53/TP53. Acts as a regulator of cellular senescence and cellular ploidy by mediating phosphorylation of 'Ser-464' of LATS1, thereby controlling its stability. Controls cell adhesion by regulating activity of the myosin protein phosphatase 1 (PP1) complex. Acts by mediating phosphorylation of PPP1R12A subunit of myosin PP1: phosphorylated PPP1R12A then interacts with 14-3-3, leading to reduced dephosphorylation of myosin MLC2 by myosin PP1. May be involved in DNA damage response: phosphorylates p53/TP53 at 'Ser-15' and 'Ser-392' and is recruited to the CDKN1A/WAF1 promoter to participate to transcription activation by p53/TP53. May also act as a tumor malignancy-associated factor by promoting tumor invasion and metastasis under regulation and phosphorylation by AKT1. Suppresses Fas-induced apoptosis by mediating phosphorylation of CASP6, thereby suppressing the activation of the caspase and the subsequent cleavage of CFLAR. Regulates UV radiation-induced DNA damage response mediated by CDKN1A. In association with STK11, phosphorylates CDKN1A in response to UV radiation and contributes to its degradation which is necessary for optimal DNA repair (PubMed:25329316).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "NUAK1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-NUAK1 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.