AMN (NM_030943) Human Tagged ORF Clone

CAT#: RC219248

Reviews ()
Write a review
  • TrueORF®

AMN (Myc-DDK-tagged)-Human amnionless homolog (mouse) (AMN)



  "NM_030943" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AMN (NM_030943) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AMN
Synonyms amnionless; PRO1028
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC219248 representing NM_030943
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGTCCTGGGCCGGGTCCTGCTGTGGCTGCAGCTCTGCGCACTGACCCAGGCGGTCTCCAAACTCT
GGGTCCCCAACACGGACTTCGACGTCGCAGCCAACTGGAGCCAGAACCGGACCCCGTGCGCCGGCGGCGC
CGTTGAGTTCCCGGCGGACAAGATGGTGTCAGTCCTGGTGCAAGAAGGTCACGCCGTCTCAGACATGCTC
CTGCCGCTGGATGGGGAACTCGTCCTGGCTTCAGGAGCCGGATTCGGCGTCTCAGACGTGGGCTCGCACC
TGGACTGTGGCGCGGGCGAACCTGCCGTCTTCCGCGACTCTGACCGCTTCTCCTGGCATGACCCGCACCT
GTGGCGCTCTGGGGACGAGGCACCTGGCCTCTTCTTCGTGGACGCCGAGCGCGTGCCCTGCCGCCACGAC
GACGTCTTCTTTCCGCCTAGTGCCTCCTTCCGCGTGGGGCTCGGCCCTGGCGCTAGCCCCGTGCGTGTCC
GCAGCATCTCGGCTCTGGGCCGGACGTTCACGCGCGACGAGGACCTGGCTGTTTTCCTGGCGTCCCGCGC
GGGCCGCCTACGCTTCCACGGGCCGGGCGCGCTGAGCGTGGGCCCCGAGGACTGCGCGGACCCGTCGGGC
TGCGTCTGCGGCAACGCGGAGGCGCAGCCGTGGATCTGCGCGGCCCTGCTCCAGCCCCTGGGCGGCCGCT
GTCCCCAGGCCGCCTGCCACTTTGCCCTCCGGCCCCAGGGGCAGTGCTGTGACCTCTGTGGAGCCGTTGT
GTTGCTGACCCACGGCCCCGCATTTGACCTGGAGCGGTACCGGGCGCGGATACTGGACACCTTCCTGGGT
CTGCCTCAGTACCACGGGCTGCAGGTGGCCGTGTCCAAGGTGCCACGCTCGTCCCGGCTCCGTGAGGCCG
ATACGGAGATCCAGGTGGTGCTGGTGGAGAATGGGCCCGAGACAGGCGGAGCGGGGCGGCTGGCCCGGGC
CCTCCTGGCGGACGTCGCCGAGAACGGCGAGGCCCTCGGCGTCCTGGAGGCGACCATGCGGGAGTCGGGC
GCACACGTCTGGGGCAGCTCCGCGGCTGGGCTGGCGGGCGGCGTGGCGGCTGCCGTGCTGCTGGCGCTGC
TGGTCCTGCTGGTGGCGCCGCCGCTGCTGCGCCGCGCGGGGAGGCTCAGGTGGAGGAGGCACGAGGCGGC
GGCCCCGGCTGGAGCGCCCCTCGGCTTCCGCAACCCGGTGTTCGACGTGACGGCCTCCGAGGAGCTGCCC
CTGCCGCGGCGGCTCAGCCTGGTTCCGAAGGCGGCCGCAGACAGCACCAGCCACAGTTACTTCGTCAACC
CTCTGTTCGCCGGGGCCGAGGCCGAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219248 representing NM_030943
Red=Cloning site Green=Tags(s)

MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDML
LPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHD
DVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPEDCADPSG
CVCGNAEAQPWICAALLQPLGGRCPQAACHFALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLG
LPQYHGLQVAVSKVPRSSRLREADTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESG
AHVWGSSAAGLAGGVAAAVLLALLVLLVAPPLLRRAGRLRWRRHEAAAPAGAPLGFRNPVFDVTASEELP
LPRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030943
ORF Size 1359 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_030943.1, NM_030943.2, NM_030943.3, NP_112205.1
RefSeq Size 1896 bp
RefSeq ORF 1362 bp
Locus ID 81693
Cytogenetics 14q32.32
Protein Families Druggable Genome, Transmembrane
MW 45.6 kDa
Gene Summary The protein encoded by this gene is a type I transmembrane protein. It is thought to modulate bone morphogenetic protein (BMP) receptor function by serving as an accessory or coreceptor, and thus facilitates or hinders BMP binding. It is known that the mouse AMN gene is expressed in the extraembryonic visceral endoderm layer during gastrulation, but it is found to be mutated in amnionless mouse. The encoded protein has sequence similarity to short gastrulation (Sog) and procollagen IIA proteins in Drosophila. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-AMN Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools