hnRNP L (HNRNPL) (NM_001533) Human Tagged ORF Clone

CAT#: RC219240

Reviews ()
Write a review

HNRNPL (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein L (HNRNPL), transcript variant 1



Reconstitution Protocol

USD 822.00

In Stock*

Size
    • 10 ug

Product images

Other products for "HNRNPL"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HNRNPL
Synonyms hnRNP-L; HNRPL; P/OKcl.14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219240 representing NM_001533
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGGAGGCTGCTGCCCCGGGCGGAGAAGCGGCGTCGGCGGCTGGAGCAGAGGCAGCAGCCGGACG
AGCAGCGGAGGCGGTCGGGAGCGATGGTGAAGATGGCGGCGGCGGGCGGCGGAGGCGGCGGTGGCCGCTA
CTACGGCGGCGGCAGTGAGGGCGGCCGGGCCCCTAAGCGGCTCAAGACTGACAACGCCGGCGACCAGCAC
GGAGGCGGCGGCGGTGGCGGTGGAGGAGCCGGGGCGGCGGGCGGCGGCGGCGGTGGGGAGAACTACGATG
ACCCGCACAAAACCCCTGCCTCCCCAGTTGTCCACATCAGGGGCCTGATTGACGGTGTGGTGGAAGCAGA
CCTTGTGGAGGCCTTGCAGGAGTTTGGACCCATCAGCTATGTGGTGGTAATGCCTAAAAAGAGACAAGCA
CTGGTGGAGTTTGAAGATGTGTTGGGGGCTTGCAACGCAGTGAACTACGCAGCCGACAACCAAATATACA
TTGCTGGTCACCCAGCTTTTGTCAACTACTCTACCAGCCAGAAGATCTCCCGCCCTGGGGACTCGGATGA
CTCCCGGAGCGTGAACAGTGTGCTTCTCTTTACCATCCTGAACCCCATTTATTCGATCACCACGGATGTT
CTTTACACTATCTGTAATCCTTGTGGCCCTGTCCAGAGAATTGTCATTTTCAGGAAGAATGGAGTTCAGG
CGATGGTGGAATTTGACTCAGTTCAAAGTGCCCAGCGGGCCAAGGCCTCTCTCAATGGGGCTGATATCTA
TTCTGGCTGTTGCACTCTGAAGATCGAATACGCAAAGCCTACACGCTTGAATGTGTTCAAGAATGATCAG
GATACTTGGGACTACACAAACCCCAATCTCAGTGGACAAGGTGACCCTGGCAGCAACCCCAACAAACGCC
AGAGGCAGCCCCCTCTCCTGGGAGATCACCCCGCAGAATATGGAGGGCCCCACGGTGGGTACCACAGCCA
TTACCATGATGAGGGCTACGGGCCCCCCCCACCTCACTACGAAGGGAGAAGGATGGGTCCACCAGTGGGG
GGTCACCGTCGGGGCCCAAGTCGCTACGGCCCCCAGTATGGGCACCCCCCACCCCCTCCCCCACCACCCG
AGTATGGCCCTCACGCCGACAGCCCTGTGCTCATGGTCTATGGCTTGGATCAATCTAAGATGAACTGTGA
CCGAGTCTTCAATGTCTTCTGCTTATATGGCAATGTGGAGAAGGTGAAATTCATGAAAAGCAAGCCGGGG
GCCGCCATGGTGGAGATGGCTGATGGCTACGCTGTAGACCGGGCCATTACCCACCTCAACAACAACTTCA
TGTTTGGGCAGAAGCTGAATGTCTGTGTCTCCAAGCAGCCAGCCATCATGCCTGGTCAGTCATACGGGTT
GGAAGACGGGTCTTGCAGTTACAAAGACTTCAGTGAATCCCGGAACAATCGGTTCTCCACCCCAGAGCAG
GCAGCCAAGAACCGCATCCAGCACCCCAGCAACGTGCTGCACTTCTTCAACGCCCCGCTGGAGGTGACCG
AGGAGAACTTCTTTGAGATCTGCGATGAGCTGGGAGTGAAGCGGCCATCTTCTGTGAAAGTATTCTCAGG
CAAAAGTGAGCGCAGCTCCTCTGGACTGCTGGAGTGGGAATCCAAGAGCGATGCCCTGGAGACTCTGGGC
TTCCTGAACCATTACCAGATGAAAAACCCAAATGGTCCATACCCTTACACTCTGAAGTTGTGTTTCTCCA
CTGCTCAGCACGCCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219240 representing NM_001533
Red=Cloning site Green=Tags(s)

MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQH
GGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQA
LVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDV
LYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQ
DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVG
GHRRGPSRYGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPG
AAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQ
AAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLG
FLNHYQMKNPNGPYPYTLKLCFSTAQHAS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001533
ORF Size 1767 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001533.2, NP_001524.2
RefSeq Size 2129 bp
RefSeq ORF 1770 bp
Locus ID 3191
UniProt ID P14866
Cytogenetics 19q13.2
Domains RRM
MW 64 kDa
Gene Summary Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.