STAM1(STAM) (NM_003473) Human Tagged ORF Clone

CAT#: RC219230

STAM (Myc-DDK-tagged)-Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 691.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name STAM1(STAM) (NM_003473) Human Tagged ORF Clone
Symbol STAM
Synonyms STAM-1; STAM1
Vector pCMV6-Entry
Sequence Data
>RC219230 representing NM_003473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCTTTTTGCCACCAATCCCTTCGATCAGGATGTTGAGAAAGCAACCAGCGAGATGAATACTGCTG
AGGACTGGGGCCTCATTTTGGATATCTGTGATAAAGTTGGTCAGTCTCGCACTGGACCTAAGGATTGTCT
TCGGTCTATTATGAGAAGAGTGAACCACAAAGATCCTCACGTTGCTATGCAGGCTTTGACTCTTCTAGGA
GCATGTGTATCAAACTGTGGCAAAATTTTTCATTTAGAAGTATGTTCAAGAGATTTTGCTAGTGAAGTAA
GCAACGTATTAAATAAGGGTCATCCTAAAGTATGTGAAAAATTAAAGGCTCTTATGGTTGAATGGACAGA
TGAATTTAAGAATGATCCACAGCTTAGTCTAATATCAGCAATGATTAAGAACCTTAAGGAACAAGGAGTT
ACGTTCCCAGCTATTGGCTCTCAGGCTGCAGAACAAGCAAAAGCAAGCCCAGCTCTTGTAGCCAAGGATC
CTGGTACTGTGGCTAACAAAAAAGAAGAAGAAGATTTAGCAAAAGCCATTGAGTTGTCTCTCAAGGAACA
AAGGCAGCAGTCAACCACCCTTTCCACTTTGTATCCAAGCACATCCAGTCTCTTAACTAACCACCAACAT
GAAGGCCGAAAAGTTCGTGCTATATATGACTTTGAAGCTGCTGAAGACAATGAACTTACTTTTAAAGCTG
GAGAAATTATTACAGTTCTTGATGACAGTGATCCTAACTGGTGGAAAGGTGAAACCCATCAAGGCATAGG
GTTATTTCCTTCTAATTTTGTGACTGCAGATCTCACTGCTGAACCAGAAATGATTAAAACAGAGAAGAAG
ACGGTACAATTTAGTGATGATGTTCAGGTAGAGACAATAGAACCAGAGCCGGAACCAGCCTTTATTGATG
AAGATAAAATGGACCAGTTGCTACAGATGCTGCAAAGTACAGACCCCAGTGATGATCAGCCAGACCTACC
AGAGCTGCTTCATCTTGAAGCAATGTGTCACCAGATGGGACCTCTCATTGATGAAAAGCTGGAAGATATT
GATAGAAAACATTCAGAACTCTCAGAACTTAATGTGAAAGTGATGGAGGCCCTTTCCTTATATACCAAGT
TAATGAACGAAGATCCGATGTATTCCATGTATGCAAAGTTACAGAATCAGCCATATTATATGCAGTCATC
TGGTGTTTCTGGTTCTCAGGTGTATGCAGGGCCTCCTCCAAGTGGTGCCTACCTGGTTGCAGGGAACGCG
CAGATGAGCCACCTCCAGAGCTACAGTCTTCCCCCGGAGCAGCTGTCTTCTCTCAGCCAGGCAGTGGTCC
CACCATCCGCAAACCCAGCCCTTCCTAGTCAGCAGACTCAGGCCGCTTACCCAAATACAATGGTCAGTTC
CGTTCAAGGAAACACATATCCCAGCCAGGCGCCAGTATATAGTCCTCCTCCTGCCGCTACTGCTGCTGCT
GCAACTGCCGATGTCACTCTGTACCAGAATGCAGGACCTAATATGCCCCAGGTGCCAAACTATAACTTAA
CATCATCAACTCTGCCTCAGCCCGGAGGCAGCCAACAGCCACCTCAGCCACAGCAACCATATTCTCAGAA
GGCTCTGCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219230 representing NM_003473
Red=Cloning site Green=Tags(s)

MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG
ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV
TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH
EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK
TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI
DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA
ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003473
ORF Size 1620 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003473.1, NM_003473.2, NM_003473.3, NP_003464
RefSeq Size 2967
RefSeq ORF 1623
Locus ID 8027
Cytogenetics 10p12.33
Domains SH3, VHS, UIM
Protein Pathways Endocytosis, Jak-STAT signaling pathway
MW 59 kDa
Gene Summary Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)