STAM1 (STAM) (NM_003473) Human Tagged ORF Clone

CAT#: RC219230

Reviews ()
Write a review

STAM (Myc-DDK-tagged)-Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1



  "NM_003473" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 567.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol STAM
Synonyms STAM-1; STAM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219230 representing NM_003473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCTTTTTGCCACCAATCCCTTCGATCAGGATGTTGAGAAAGCAACCAGCGAGATGAATACTGCTG
AGGACTGGGGCCTCATTTTGGATATCTGTGATAAAGTTGGTCAGTCTCGCACTGGACCTAAGGATTGTCT
TCGGTCTATTATGAGAAGAGTGAACCACAAAGATCCTCACGTTGCTATGCAGGCTTTGACTCTTCTAGGA
GCATGTGTATCAAACTGTGGCAAAATTTTTCATTTAGAAGTATGTTCAAGAGATTTTGCTAGTGAAGTAA
GCAACGTATTAAATAAGGGTCATCCTAAAGTATGTGAAAAATTAAAGGCTCTTATGGTTGAATGGACAGA
TGAATTTAAGAATGATCCACAGCTTAGTCTAATATCAGCAATGATTAAGAACCTTAAGGAACAAGGAGTT
ACGTTCCCAGCTATTGGCTCTCAGGCTGCAGAACAAGCAAAAGCAAGCCCAGCTCTTGTAGCCAAGGATC
CTGGTACTGTGGCTAACAAAAAAGAAGAAGAAGATTTAGCAAAAGCCATTGAGTTGTCTCTCAAGGAACA
AAGGCAGCAGTCAACCACCCTTTCCACTTTGTATCCAAGCACATCCAGTCTCTTAACTAACCACCAACAT
GAAGGCCGAAAAGTTCGTGCTATATATGACTTTGAAGCTGCTGAAGACAATGAACTTACTTTTAAAGCTG
GAGAAATTATTACAGTTCTTGATGACAGTGATCCTAACTGGTGGAAAGGTGAAACCCATCAAGGCATAGG
GTTATTTCCTTCTAATTTTGTGACTGCAGATCTCACTGCTGAACCAGAAATGATTAAAACAGAGAAGAAG
ACGGTACAATTTAGTGATGATGTTCAGGTAGAGACAATAGAACCAGAGCCGGAACCAGCCTTTATTGATG
AAGATAAAATGGACCAGTTGCTACAGATGCTGCAAAGTACAGACCCCAGTGATGATCAGCCAGACCTACC
AGAGCTGCTTCATCTTGAAGCAATGTGTCACCAGATGGGACCTCTCATTGATGAAAAGCTGGAAGATATT
GATAGAAAACATTCAGAACTCTCAGAACTTAATGTGAAAGTGATGGAGGCCCTTTCCTTATATACCAAGT
TAATGAACGAAGATCCGATGTATTCCATGTATGCAAAGTTACAGAATCAGCCATATTATATGCAGTCATC
TGGTGTTTCTGGTTCTCAGGTGTATGCAGGGCCTCCTCCAAGTGGTGCCTACCTGGTTGCAGGGAACGCG
CAGATGAGCCACCTCCAGAGCTACAGTCTTCCCCCGGAGCAGCTGTCTTCTCTCAGCCAGGCAGTGGTCC
CACCATCCGCAAACCCAGCCCTTCCTAGTCAGCAGACTCAGGCCGCTTACCCAAATACAATGGTCAGTTC
CGTTCAAGGAAACACATATCCCAGCCAGGCGCCAGTATATAGTCCTCCTCCTGCCGCTACTGCTGCTGCT
GCAACTGCCGATGTCACTCTGTACCAGAATGCAGGACCTAATATGCCCCAGGTGCCAAACTATAACTTAA
CATCATCAACTCTGCCTCAGCCCGGAGGCAGCCAACAGCCACCTCAGCCACAGCAACCATATTCTCAGAA
GGCTCTGCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219230 representing NM_003473
Red=Cloning site Green=Tags(s)

MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG
ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV
TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH
EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK
TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI
DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA
ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003473
ORF Size 1620 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003473.4
RefSeq Size 2967 bp
RefSeq ORF 1623 bp
Locus ID 8027
UniProt ID Q92783
Cytogenetics 10p12.33
Domains SH3, VHS, UIM
Protein Pathways Endocytosis, Jak-STAT signaling pathway
MW 59 kDa
Gene Summary This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]

Other Versions

Other products for "STAM"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-STAM Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.