CACNA1I (NM_021096) Human Tagged ORF Clone

CAT#: RC219179

CACNA1I (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CACNA1I (NM_021096) Human Tagged ORF Clone
Symbol CACNA1I
Synonyms ca(v)3.3; Cav3.3; ca(v)3.3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC219179 representing NM_021096
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGAGCGCCTCCCCGCCCTCCTCATCTGCAGCAGCCCCAGCCGCTGAGCCAGGAGTCACCACGG
AGCAGCCCGGACCCCGGAGCCCCCCATCCTCCCCGCCAGGCCTGGAGGAGCCTCTGGATGGAGCTGATCC
TCATGTCCCACACCCAGACCTGGCGCCTATTGCCTTCTTCTGCCTGCGACAGACCACCAGCCCCCGGAAC
TGGTGCATCAAGATGGTGTGCAACCCGTGGTTTGAATGTGTCAGCATGCTGGTGATCCTGCTGAACTGCG
TGACACTTGGCATGTACCAGCCGTGCGACGACATGGACTGCCTGTCCGACCGCTGCAAGATCCTGCAGGT
CTTTGATGACTTCATCTTTATCTTCTTTGCCATGGAGATGGTGCTCAAGATGGTGGCCCTGGGGATTTTT
GGCAAGAAGTGCTACCTCGGGGACACATGGAACCGCCTGGATTTCTTCATCGTCATGGCAGGGATGGTCG
AGTACTCCCTGGACCTTCAGAACATCAACCTGTCAGCCATCCGCACCGTGCGCGTCCTGAGGCCCCTCAA
AGCCATCAACCGCGTGCCCAGTATGCGGATCCTGGTGAACCTGCTCCTGGACACACTGCCCATGCTGGGG
AATGTCCTGCTGCTCTGCTTCTTTGTCTTCTTCATCTTTGGCATCATAGGTGTGCAGCTCTGGGCGGGCC
TGCTGCGTAACCGCTGCTTCCTGGAGGAGAACTTCACCATACAAGGGGATGTGGCCTTGCCCCCATACTA
CCAGCCGGAGGAGGATGATGAGATGCCCTTCATCTGCTCCCTGTCGGGCGACAATGGGATAATGGGCTGC
CATGAGATCCCCCCGCTCAAGGAGCAGGGCCGTGAGTGCTGCCTGTCCAAGGACGACGTCTACGACTTTG
GGGCGGGGCGCCAGGACCTCAATGCCAGCGGCCTCTGTGTCAACTGGAACCGTTACTACAATGTGTGCCG
CACGGGCAGCGCCAACCCCCACAAGGGTGCCATCAACTTTGACAACATCGGTTATGCTTGGATTGTCATC
TTCCAGGTGATCACTCTGGAAGGCTGGGTGGAGATCATGTACTACGTGATGGATGCTCACTCCTTCTACA
ACTTCATCTACTTCATCCTGCTTATCATAGTGGGCTCCTTCTTCATGATCAACCTGTGCCTCGTTGTCAT
AGCGACCCAGTTCTCGGAGACCAAGCAACGGGAGCACCGGCTGATGCTGGAGCAGCGGCAGCGCTACCTG
TCCTCCAGCACGGTGGCCAGCTACGCCGAGCCTGGCGACTGCTACGAGGAGATCTTCCAGTATGTCTGCC
ACATCCTGCGCAAGGCCAAGCGCCGCGCCCTGGGCCTCTACCAGGCCCTGCAGAGCCGGCGCCAGGCCCT
GGGCCCGGAGGCCCCGGCCCCCGCCAAACCTGGGCCCCACGCCAAGGAGCCCCGGCACTACCATGGGAAG
ACTAAGGGTCAGGGAGATGAAGGGAGACATCTCGGAAGCCGGCATTGCCAGACTTTGCATGGGCCTGCCT
CCCCTGGAAATGATCACTCGGGAAGAGAGCTGTGCCCGCAACATAGCCCCCTGGATGCGACGCCCCACAC
CCTGGTGCAGCCCATCCCCGCCACGCTGGCTTCCGATCCCGCCAGCTGCCCTTGCTGCCAGCATGAGGAC
GGCCGGCGGCCCTCGGGCCTGGGCAGCACCGACTCGGGCCAGGAGGGCTCGGGCTCCGGGAGCTCCGCTG
GTGGCGAGGACGAGGCGGATGGGGACGGGGCCCGGAGCAGCGAGGACGGAGCCTCCTCAGAACTGGGGAA
GGAGGAGGAGGAGGAGGAGCAGGCGGATGGGGCGGTCTGGCTGTGCGGGGATGTGTGGCGGGAGACGCGA
GCCAAGCTGCGCGGCATCGTGGACAGCAAGTACTTCAACCGGGGCATCATGATGGCCATCCTGGTCAACA
CCGTCAGCATGGGCATCGAGCACCACGAGCAGCCGGAGGAGCTGACCAACATCCTGGAGATCTGCAATGT
GGTCTTCACCAGCATGTTTGCCCTGGAGATGATCCTGAAGCTGGCTGCATTTGGGCTCTTCGACTACCTG
CGTAACCCCTACAACATCTTCGACAGCATCATTGTCATCATCAGCATCTGGGAGATTGTGGGGCAGGCGG
ACGGTGGGCTGTCGGTGCTGCGGACCTTCCGGCTGCTGCGCGTGCTGAAACTGGTGCGCTTCATGCCTGC
CCTGCGGCGCCAGCTCGTGGTGCTCATGAAGACCATGGACAACGTGGCCACCTTCTGCATGCTGCTCATG
CTCTTCATCTTCATCTTCAGCATCCTTGGGATGCATATTTTTGGCTGCAAGTTCAGCCTCCGCACGGACA
CTGGAGACACGGTGCCCGACAGGAAGAACTTCGACTCCCTGCTGTGGGCCATCGTCACTGTGTTCCAGAT
CCTCACCCAGGAGGACTGGAACGTCGTTCTCTACAATGGCATGGCCTCCACTTCTCCCTGGGCCTCCCTC
TACTTTGTCGCCCTCATGACCTTCGGCAACTATGTGCTCTTCAACCTGCTGGTGGCCATCCTGGTGGAGG
GCTTCCAGGCGGAGGGTGACGCCAATCGCTCCTACTCGGACGAGGACCAGAGCTCATCCAACATAGAAGA
GTTTGATAAGCTCCAGGAAGGCCTGGACAGCAGCGGAGATCCCAAGCTCTGCCCAATCCCCATGACCCCC
AATGGGCACCTGGACCCCAGTCTCCCACTGGGTGGGCACCTAGGTCCTGCTGGGGCTGCGGGACCTGCCC
CCCGACTCTCACTGCAGCCGGACCCCATGCTGGTGGCCCTGGGCTCCCGAAAGAGCAGTGTCATGTCTCT
AGGGAGGATGAGCTATGACCAGCGCTCCCTGTCCAGCTCCCGGAGCTCCTACTACGGGCCATGGGGCCGC
AGCGCGGCCTGGGCCAGCCGTCGCTCCAGCTGGAACAGCCTCAAGCACAAGCCGCCGTCGGCGGAGCATG
AGTCCCTGCTCTCTGCGGAGCGCGGCGGCGGCGCCCGGGTCTGCGAGGTTGCCGCGGACGAGGGGCCGCC
GCGGGCCGCACCCCTGCACACCCCACACGCCCACCACATTCATCACGGGCCCCATCTGGCGCACCGCCAC
CGCCACCACCGCCGGACGCTGTCCCTCGACAACAGGGACTCGGTGGACCTGGCCGAGCTGGTGCCCGCGG
TGGGCGCCCACCCCCGGGCCGCCTGGAGGGCGGCAGGCCCGGCCCCCGGGCATGAGGACTGCAATGGCAG
GATGCCCAGCATCGCCAAAGACGTCTTCACCAAGATGGGCGACCGCGGGGATCGCGGGGAGGATGAGGAG
GAAATCGACTACACCCTGTGCTTCCGCGTCCGCAAGATGATCGACGTCTATAAGCCCGACTGGTGCGAGG
TCCGCGAAGACTGGTCTGTCTACCTCTTCTCTCCCGAGAACAGGTTCCGGGTCCTGTGTCAGACCATTAT
TGCCCACAAACTCTTCGACTACGTCGTCCTGGCCTTCATCTTTCTCAACTGCATCACCATCGCCCTGGAG
CGGCCTCAGATCGAGGCCGGCAGCACCGAACGCATCTTTCTCACCGTGTCCAACTACATCTTCACGGCCA
TCTTCGTGGGCGAGATGACATTGAAGGTAGTCTCGCTGGGCCTGTACTTCGGCGAGCAGGCGTACCTACG
CAGCAGCTGGAACGTGCTGGATGGCTTTCTTGTCTTCGTGTCCATCATCGACATCGTGGTGTCCCTGGCC
TCAGCCGGGGGAGCCAAGATCTTGGGGGTCCTCCGAGTCTTGCGGCTCCTGCGCACCCTACGCCCCCTGC
GTGTCATCAGCCGGGCGCCGGGCCTGAAGCTGGTGGTGGAGACACTCATCTCCTCCCTCAAGCCCATCGG
CAACATCGTGCTCATCTGCTGTGCCTTCTTCATCATCTTTGGCATCCTGGGAGTGCAGCTCTTCAAGGGC
AAGTTCTACCACTGTCTGGGCGTGGACACCCGCAACATCACCAACCGCTCGGACTGCATGGCCGCCAACT
ACCGCTGGGTCCATCACAAATACAACTTCGACAACCTGGGCCAGGCTCTGATGTCCCTCTTTGTCCTGGC
ATCCAAGGATGGTTGGGTGAACATCATGTACAATGGACTGGATGCTGTTGCTGTGGACCAGCAGCCTGTG
ACCAACCACAACCCCTGGATGCTGCTGTACTTCATCTCCTTCCTGCTCATCGTCAGCTTCTTTGTGCTCA
ACATGTTTGTGGGTGTCGTGGTGGAGAACTTCCACAAGTGCCGGCAGCACCAGGAGGCTGAAGAGGCACG
GCGGCGTGAGGAGAAGCGGCTGCGGCGCCTGGAGAAGAAGCGCCGGAAGGCCCAGCGGCTGCCCTACTAT
GCCACCTATTGTCACACCCGGCTGCTCATCCACTCCATGTGCACCAGCCACTACCTGGACATCTTCATCA
CCTTCATCATCTGCCTCAACGTGGTCACCATGTCCCTGGAGCACTACAATCAGCCCACGTCCCTGGAGAC
AGCCCTCAAGTACTGCAACTATATGTTCACCACTGTCTTTGTGCTGGAGGCTGTGCTGAAGCTGGTGGCA
TTTGGTCTGAGGCGCTTCTTCAAGGACCGATGGAACCAGCTGGACCTGGCCATTGTGCTACTGTCAGTCA
TGGGCATCACCCTGGAGGAGATCGAGATCAATGCGGCCCTGCCCATCAATCCCACCATCATCCGCATCAT
GAGGGTTCTGCGCATTGCCCGAGTGCTGAAGCTGTTGAAGATGGCCACAGGAATGCGGGCCCTGCTGGAC
ACGGTGGTGCAAGCTTTGCCCCAGGTGGGCAACCTGGGCCTCCTCTTCATGCTGCTCTTCTTCATCTATG
CTGCTCTCGGGGTGGAGCTCTTTGGGAAGCTGGTCTGCAACGACGAGAACCCGTGCGAGGGCATGAGCCG
GCATGCCACCTTCGAGAACTTCGGCATGGCCTTCCTCACACTCTTCCAGGTCTCCACGGGTGACAACTGG
AACGGGATCATGAAGGACACGCTGCGGGACTGCACCCACGACGAGCGCAGCTGCCTGAGCAGCCTGCAGT
TTGTGTCGCCGCTGTACTTCGTGAGCTTCGTGCTCACCGCGCAGTTCGTGCTCATCAACGTGGTGGTGGC
TGTGCTCATGAAGCACCTGGACGACAGCAACAAGGAGGCGCAGGAGGACGCCGAGATGGATGCCGAGCTC
GAGCTGGAGATGGCCCATGGCCTGGGCCCTGGCCCGAGGCTGCCTACCGGCTCCCCGGGCGCCCCTGGCC
GAGGGCCGGGAGGGGCGGGCGGCGGGGGCGACACCGAGGGCGGCTTGTGCCGGCGCTGCTACTCGCCTGC
CCAGGAGAACCTGTGGCTGGACAGCGTCTCTTTAATCATCAAGGACTCCTTGGAGGGGGAGCTGACCATC
ATCGACAACCTGTCGGGCTCCATCTTCCACCACTACTCCTCGCCTGCCGGCTGCAAGAAGTGTCACCACG
ACAAGCAAGAGGTGCAGCTGGCTGAGACGGAGGCCTTCTCCCTGAACTCAGACAGGTCCTCGTCCATCCT
GCTGGGTGACGACCTGAGTCTCGAGGACCCCACAGCCTGCCCACCTGGCCGCAAAGACAGCAAGGGTGAG
CTGGACCCACCTGAGCCCATGCGTGTGGGAGACCTGGGCGAATGCTTCTTCCCCTTGTCCTCTACGGCCG
TCTCGCCGGATCCAGAGAACTTCCTGTGTGAGATGGAGGAGATCCCATTCAACCCTGTCCGGTCCTGGCT
GAAACATGACAGCAGTCAAGCACCCCCAAGTCCCTTCTCCCCGGATGCCTCCAGCCCTCTCCTGCCCATG
CCAGCCGAGTTCTTCCACCCTGCAGTGTCTGCCAGCCAGAAAGGCCCAGAAAAGGGCACTGGCACTGGAA
CCCTCCCCAAGATTGCGCTGCAGGGCTCCTGGGCATCTCTGCGGTCACCAAGGGTCAACTGTACCCTCCT
CCGGCAGGCCACCGGGAGCGACACGTCGCTGGACGCCAGCCCCAGCAGCTCCGCGGGCAGCCTGCAGACC
ACGCTCGAGGACAGCCTGACCCTGAGCGACAGCCCCCGGCGTGCCCTGGGGCCGCCCGCGCCTGCTCCAG
GACCCCGGGCCGGCCTGTCCCCCGCCGCTCGCCGCCGCCTGAGCCTGCGCGGCCGGGGCCTCTTCAGCCT
GCGGGGGCTGCGGGCGCATCAGCGCAGCCACAGCAGCGGGGGCTCCACCAGCCCGGGCTGCACCCACCAC
GACTCCATGGACCCCTCGGACGAGGAGGGCCGCGGTGGCGCGGGCGGCGGGGGCGCGGGCAGCGAGCACT
CGGAGACCCTCAGCAGCCTCTCGCTCACCTCCCTCTTCTGCCCGCCGCCCCCGCCGCCAGCCCCCGGCCT
CACGCCCGCCAGGAAGTTCAGCAGCACCAGCAGCCTGGCCGCCCCCGGCCGCCCCCACGCCGCCGCCCTG
GCCCACGGCCTGGCCCGGAGCCCCTCGTGGGCCGCGGACCGCAGCAAGGACCCCCCCGGCCGGGCACCGC
TGCCCATGGGCCTGGGCCCCTTGGCGCCCCCGCCGCAACCGCTCCCCGGAGAGCTGGAGCCGGGAGACGC
CGCCAGCAAGAGGAAGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219179 representing NM_021096
Red=Cloning site Green=Tags(s)

MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPIAFFCLRQTTSPRN
WCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIF
GKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLG
NVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGC
HEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVI
FQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPHAKEPRHYHGK
TKGQGDEGRHLGSRHCQTLHGPASPGNDHSGRELCPQHSPLDATPHTLVQPIPATLASDPASCPCCQHED
GRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGARSSEDGASSELGKEEEEEEQADGAVWLCGDVWRETR
AKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYL
RNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLM
LFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDSSGDPKLCPIPMTP
NGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGR
SAAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEVAADEGPPRAAPLHTPHAHHIHHGPHLAHRH
RHHRRTLSLDNRDSVDLAELVPAVGAHPRAAWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDRGEDEE
EIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALE
RPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLA
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKG
KFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPV
TNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYY
ATYCHTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVA
FGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLD
TVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW
NGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEL
ELEMAHGLGPGPRLPTGSPGAPGRGPGGAGGGGDTEGGLCRRCYSPAQENLWLDSVSLIIKDSLEGELTI
IDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGE
LDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASSPLLPM
PAEFFHPAVSASQKGPEKGTGTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQT
TLEDSLTLSDSPRRALGPPAPAPGPRAGLSPAARRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHH
DSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPAPGLTPARKFSSTSSLAAPGRPHAAAL
AHGLARSPSWAADRSKDPPGRAPLPMGLGPLAPPPQPLPGELEPGDAASKRKR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021096
ORF Size 6669 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021096.2, NM_021096.3, NP_066919
RefSeq Size 10007
RefSeq ORF 6672
Locus ID 8911
Cytogenetics 22q13.1
Protein Families Ion Channels: Calcium, Transmembrane, Druggable Genome
Protein Pathways MAPK signaling pathway, Calcium signaling pathway
MW 244.9 kDa
Gene Summary This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation compared to other T-type calcium channels. This protein may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations