FBXO7 (NM_001033024) Human Tagged ORF Clone

CAT#: RC218979

FBXO7 (Myc-DDK-tagged)-Human F-box protein 7 (FBXO7), transcript variant 2

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FBXO7 (NM_001033024) Human Tagged ORF Clone
Symbol FBXO7
Synonyms FBX; FBX07; FBX7; PARK15; PKPS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC218979 representing NM_001033024
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGGCCTCCCGGGGGCTCTGGTCCCCTCCTCGATTCAGAGCATTCTTCACTCCAGAATAATGAGC
AACCCTCTTTGGCCACCAGCTCCAATCAGACTAGCATGCAGGATGAACAACCAAGTGATTCATTCCAAGG
ACAGGCAGCCCAGTCTGGTGTTTGGAATGACGACAGTATGTTAGGGCCTAGTCAAAATTTTGAAGCTGAG
TCAATTCAAGATAATGCGCATATGGCAGAGGGCACAGGTTTCTATCCCTCAGAACCCATGCTCTGTAGTG
AATCGGTGGAAGGGCAAGTGCCACATTCATTAGAGACCTTGTATCAATCAGCTGACTGTTCTGATGCCAA
TGATGCCTTGATAGTGTTGATACATCTTCTCATGTTGGAGTCAGGTTACATACCTCAGGGCACCGAAGCC
AAAGCACTGTCCATGCCGGAGAAGTGGAAGTTGAGCGGGGTGTATAAGCTGCAGTACATGCATCCTCTCT
GCGAGGGCAGCTCCGCTACTCTCACCTGTGTGCCTTTGGGAAACCTGATTGTTGTAAATGCTACACTAAA
AATCAACAATGAGATTAGAAGTGTGAAAAGATTGCAGCTGCTACCAGAATCTTTTATTTGCAAAGAGAAA
CTAGGGGAAAATGTAGCCAACATATACAAAGATCTTCAGAAACTCTCTCGCCTCTTTAAAGACCAGCTGG
TGTATCCTCTTCTGGCTTTTACCCGACAAGCACTGAACCTACCAGATGTATTTGGGTTGGTCGTCCTCCC
ATTGGAACTGAAACTACGGATCTTCCGACTTCTGGATGTTCGTTCCGTCTTGTCTTTGTCTGCGGTTTGT
CGTGACCTCTTTACTGCTTCAAATGACCCACTCCTGTGGAGGTTTTTATATCTGCGTGATTTTCGAGACA
ATACTGTCAGAGTTCAAGACACAGATTGGAAAGAACTGTACAGGAAGAGGCACATACAAAGAAAAGAATC
CCCGAAAGGGCGGTTTGTGATGCTCCTGCCATCGTCAACTCACACCATTCCATTCTATCCCAACCCCTTG
CACCCTAGGCCATTTCCTAGCTCCCGCCTTCCTCCAGGAATTATCGGGGGTGAATATGACCAAAGACCAA
CACTTCCCTATGTTGGAGACCCAATCAGTTCACTCATTCCTGGTCCTGGGGAGACGCCCAGCCAGTTTCC
TCCACTGAGACCACGCTTTGATCCAGTTGGCCCACTTCCAGGACCTAACCCCATCTTGCCAGGGCGAGGC
GGCCCCAATGACAGATTTCCCTTTAGACCCAGCAGGGGTCGGCCAACTGATGGCCGGCTGTCATTCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218979 representing NM_001033024
Red=Cloning site Green=Tags(s)

MARPPGGSGPLLDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAE
SIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEA
KALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEK
LGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVC
RDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPL
HPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRG
GPNDRFPFRPSRGRPTDGRLSFM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001033024
ORF Size 1329 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001033024.1, NP_001028196
RefSeq Size 1758
RefSeq ORF 1332
Locus ID 25793
Cytogenetics 22q12.3
Protein Families Druggable Genome
MW 49.2 kDa
Gene Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations