PTPN22 (NM_015967) Human Tagged ORF Clone

CAT#: RC218969

Reviews ()
Write a review

PTPN22 (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 22 (lymphoid) (PTPN22), transcript variant 1



  "NM_015967" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PTPN22
Synonyms LYP; LYP1; LYP2; PEP; PTPN8; PTPN22.5; PTPN22.6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218969 representing NM_015967.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGACCAAAGAGAAATTCTGCAGAAGTTCCTGGATGAGGCCCAAAGCAAGAAAATTACTAAAGAGGAG
TTTGCCAATGAATTTCTGAAGCTGAAAAGGCAATCTACCAAGTACAAGGCAGACAAAACCTATCCTACA
ACTGTGGCTGAGAAGCCCAAGAATATCAAGAAAAACAGATATAAGGATATTTTGCCCTATGATTATAGC
CGGGTAGAACTATCCCTGATAACCTCTGATGAGGATTCCAGCTACATCAATGCCAACTTCATTAAGGGA
GTTTATGGACCCAAGGCTTATATTGCCACCCAGGGTCCTTTATCTACAACCCTCCTGGACTTCTGGAGG
ATGATTTGGGAATATAGTGTCCTTATCATTGTTATGGCATGCATGGAGTATGAAATGGGAAAGAAAAAG
TGTGAGCGCTACTGGGCTGAGCCAGGAGAGATGCAGCTGGAATTTGGCCCTTTCTCTGTATCCTGTGAA
GCTGAAAAAAGGAAATCTGATTATATAATCAGGACTCTAAAAGTTAAGTTCAATAGTGAAACTCGAACT
ATCTACCAGTTTCATTACAAGAATTGGCCAGACCATGATGTACCTTCATCTATAGACCCTATTCTTGAG
CTCATCTGGGATGTACGTTGTTACCAAGAGGATGACAGTGTTCCCATATGCATTCACTGCAGTGCTGGC
TGTGGAAGGACTGGTGTTATTTGTGCTATTGATTATACATGGATGTTGCTAAAAGATGGGATAATTCCT
GAGAACTTCAGTGTTTTCAGTTTGATCCGGGAAATGCGGACACAGAGGCCTTCATTAGTTCAAACGCAG
GAACAATATGAACTGGTCTACAATGCTGTATTAGAACTATTTAAGAGACAGATGGATGTTATCAGAGAT
AAACATTCTGGAACAGAGAGTCAAGCAAAGCATTGTATTCCTGAGAAAAATCACACTCTCCAAGCAGAC
TCTTATTCTCCTAATTTACCAAAAAGTACCACAAAAGCAGCAAAAATGATGAACCAACAAAGGACAAAA
ATGGAAATCAAAGAATCTTCTTCCTTTGACTTTAGGACTTCTGAAATAAGTGCAAAAGAAGAGCTAGTT
TTGCACCCTGCTAAATCAAGCACTTCTTTTGACTTTCTGGAGCTAAATTACAGTTTTGACAAAAATGCT
GACACAACCATGAAATGGCAGACAAAGGCATTTCCAATAGTTGGGGAGCCTCTTCAGAAGCATCAAAGT
TTGGATTTGGGCTCTCTTTTGTTTGAGGGATGTTCTAATTCTAAACCTGTAAATGCAGCAGGAAGATAT
TTTAATTCAAAGGTGCCAATAACACGGACCAAATCAACTCCTTTTGAATTGATACAGCAGAGAGAAACC
AAGGAGGTGGACAGCAAGGAAAACTTTTCTTATTTGGAATCTCAACCACATGATTCTTGTTTTGTAGAG
ATGCAGGCTCAAAAAGTAATGCATGTTTCTTCAGCAGAACTGAATTATTCACTGCCATATGACTCTAAA
CACCAAATACGTAATGCCTCTAATGTAAAGCACCATGACTCTAGTGCTCTTGGTGTATATTCTTACATA
CCTTTAGTGGAAAATCCTTATTTTTCATCATGGCCTCCAAGTGGTACCAGTTCTAAGATGTCTCTTGAT
TTACCTGAGAAGCAAGATGGAACTGTTTTTCCTTCTTCTCTGTTGCCAACATCCTCTACATCCCTCTTC
TCTTATTACAATTCACATGATTCTTTATCACTGAATTCTCCAACCAATATTTCCTCACTATTGAACCAG
GAGTCAGCTGTACTAGCAACTGCTCCAAGGATAGATGATGAAATCCCCCCTCCACTTCCTGTACGGACA
CCTGAATCATTTATTGTGGTTGAGGAAGCTGGAGAATTCTCACCAAATGTTCCCAAATCCTTATCCTCA
GCTGTGAAGGTAAAAATTGGAACATCACTGGAATGGGGTGGAACATCTGAACCAAAGAAATTTGATGAC
TCTGTGATACTTAGACCAAGCAAGAGTGTAAAACTCCGAAGTCCTAAATCAGAACTACATCAAGATCGT
TCTTCTCCCCCACCTCCTCTCCCAGAAAGAACTCTAGAGTCCTTCTTTCTTGCCGATGAAGATTGTATG
CAGGCCCAATCTATAGAAACATATTCTACTAGCTATCCTGACACCATGGAAAATTCAACATCTTCAAAA
CAGACACTGAAGACTCCTGGAAAAAGTTTCACAAGGAGTAAGAGTTTGAAAATTTTGCGAAACATGAAA
AAGAGTATCTGTAATTCTTGCCCACCAAACAAGCCTGCAGAATCTGTTCAGTCAAATAACTCCAGCTCA
TTTCTGAATTTTGGTTTTGCAAACCGTTTTTCAAAACCCAAAGGACCAAGGAATCCACCACCAACTTGG
AATATT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC218969
Blue=ORF Red=Cloning site Green=Tag(s)

MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYS
RVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKK
CERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILE
LIWDVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQ
EQYELVYNAVLELFKRQMDVIRDKHSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTK
MEIKESSSFDFRTSEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQS
LDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSCFVE
MQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSWPPSGTSSKMSLD
LPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPRIDDEIPPPLPVRT
PESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRSPKSELHQDR
SSPPPPLPERTLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMK
KSICNSCPPNKPAESVQSNNSSSFLNFGFANRFSKPKGPRNPPPTWNI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015967
ORF Size 2421 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015967.7
RefSeq Size 3615 bp
RefSeq ORF 2424 bp
Locus ID 26191
UniProt ID Q9Y2R2
Cytogenetics 1p13.2
Domains Y_phosphatase, PTPc_motif
Protein Families Druggable Genome, Phosphatase
MW 91.7 kDa
Gene Summary This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Mar 2009]

Other Versions

Other products for "PTPN22"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


PTPN22 mouse monoclonal antibody,clone OTI6B1
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.