GABARAP (NM_007278) Human Tagged ORF Clone

SKU
RC218961
GABARAP (Myc-DDK-tagged)-Human GABA(A) receptor-associated protein (GABARAP)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GABARAP
Synonyms ATG8A; GABARAP-a; MM46
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218961 representing NM_007278
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTCGTGTACAAAGAAGAGCATCCGTTCGAGAAGCGCCGCTCTGAGGGCGAGAAGATCCGAAAGA
AATACCCGGACCGGGTGCCGGTGATAGTAGAAAAGGCTCCCAAAGCTCGGATAGGAGACCTGGACAAAAA
GAAATACCTGGTGCCTTCTGATCTCACAGTTGGTCAGTTCTACTTCTTGATCCGGAAGCGAATTCATCTC
CGAGCTGAGGATGCCTTGTTTTTCTTTGTCAACAATGTCATTCCACCCACCAGTGCCACAATGGGTCAGC
TGTACCAGGAACACCATGAAGAAGACTTCTTTCTCTACATTGCCTACAGTGACGAAAGTGTCTACGGTCT
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218961 representing NM_007278
Red=Cloning site Green=Tags(s)

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL
RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007278
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007278.2
RefSeq Size 924 bp
RefSeq ORF 354 bp
Locus ID 11337
UniProt ID O95166
Cytogenetics 17p13.1
Domains MAP1_LC3
Protein Families Druggable Genome
Protein Pathways Regulation of autophagy
MW 13.7 kDa
Summary Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GABARAP (NM_007278) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218961L1 Lenti ORF clone of Human GABA(A) receptor-associated protein (GABARAP), Myc-DDK-tagged 10 ug
$450.00
RC218961L2 Lenti ORF clone of Human GABA(A) receptor-associated protein (GABARAP), mGFP tagged 10 ug
$450.00
RC218961L3 Lenti ORF clone of Human GABA(A) receptor-associated protein (GABARAP), Myc-DDK-tagged 10 ug
$450.00
RC218961L4 Lenti ORF clone of Human GABA(A) receptor-associated protein (GABARAP), mGFP tagged 10 ug
$450.00
RG218961 GABARAP (tGFP-tagged) - Human GABA(A) receptor-associated protein (GABARAP) 10 ug
$489.00
SC115633 GABARAP (untagged)-Human GABA(A) receptor-associated protein (GABARAP) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.