LIPT1 (NM_145197) Human Tagged ORF Clone

CAT#: RC218958

Reviews ()
Write a review

LIPT1 (Myc-DDK-tagged)-Human lipoyltransferase 1 (LIPT1), nuclear gene encoding mitochondrial protein, transcript variant 3


  "NM_145197" in other vectors (4)

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name LIPT1 (NM_145197) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LIPT1
Synonyms LIPT1D
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC218958 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGATCCCATTTTCAATGAAGAATTGCTTCCAGTTACTTTGTAACTGCCAGGTCCCAGCAGCTGGCT
TTAAAAAAACAGTAAAAAATGGGCTCATTTTACAGTCAATTTCCAATGATGTCTATCAAAATCTGGCTGT
GGAAGACTGGATCCATGACCATATGAATCTAGAAGGCAAACCAATTCTATTCTTTTGGCAGAATTCTCCC
TCTGTTGTAATTGGTAGGCATCAAAATCCTTGGCAGGAATGTAACCTGAATCTAATGAGAGAAGAAGGTA
TAAAACTGGCTCGGAGAAGAAGTGGAGGAGGAACAGTCTACCATGATATGGGTAATATCAATTTGACTTT
CTTTACAACCAAAAAAAAGTATGATAGAATGGAAAATCTGAAATTAATTGTGAGAGCTCTGAATGCTGTC
CAACCCCAGCTGGATGTGCAGGCTACCAAAAGATTTGACCTTTTACTTGATGGACAGTTTAAAATCTCAG
GAACAGCTTCTAAGATCGGCCGGACTACTGCCTATCACCATTGCACTTTATTATGTAGTACTGATGGGAC
GTTCTTGTCTTCTTTGCTAAAGAGCCCTTACCAAGGGATCAGGAGCAATGCCACTGCTAGCATACCTTCC
TTAGTGAAAAATCTTTTGGAAAAGGATCCCACTCTGACCTGTGAAGTACTAATGAATGCTGTTGCTACAG
AGTATGCTGCTTATCATCAAATTGATAATCACATTCACCTAATAAACCCAACGGATGAGACACTGTTTCC
TGGAATAAATAGCAAAGCCAAAGAACTGCAAACTTGGGAGTGGATATATGGCAAAACTCCAAAGTTTAGT
ATAAATACTTCCTTTCATGTGTTATATGAACAGTCACACTTGGAAATTAAAGTATTCATAGACATAAAGA
ATGGAAGAATTGAAATTTGTAATATTGAAGCACCTGATCATTGGTTGCCATTGGAAATACGTGACAAATT
AAATTCAAGTCTTATTGGCAGTAAGTTTTGCCCAACTGAAACTACCATGCTAACAAATATATTACTTAGA
ACATGTCCACAAGACCACAAACTAAACAGTAAATGGAATATTCTCTGTGAAAAAATTAAGGGAATAATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218958 protein sequence
Red=Cloning site Green=Tags(s)

MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLEGKPILFFWQNSP
SVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLIVRALNAV
QPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDGTFLSSLLKSPYQGIRSNATASIPS
LVKNLLEKDPTLTCEVLMNAVATEYAAYHQIDNHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPKFS
INTSFHVLYEQSHLEIKVFIDIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLR
TCPQDHKLNSKWNILCEKIKGIM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_145197
ORF Size 1119 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_145197.1, NM_145197.2, NP_660198.1
RefSeq Size 1584
RefSeq ORF 1122
Locus ID 51601
Cytogenetics 2q11.2
Domains BPL_LipA_LipB
Protein Pathways Lipoic acid metabolism, Metabolic pathways
MW 42.5 kDa
Gene Summary The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety to apoproteins. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 13. Read-through transcription also exists between this gene and the neighboring downstream mitochondrial ribosomal protein L30 (MRPL30) gene. [provided by RefSeq, Mar 2011]

Other Versions

Other products for "LIPT1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-LIPT1 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools