AUTS2 (NM_015570) Human Tagged ORF Clone

CAT#: RC218943

AUTS2 (Myc-DDK-tagged)-Human autism susceptibility candidate 2 (AUTS2), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,927.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AUTS2 (NM_015570) Human Tagged ORF Clone
Symbol AUTS2
Synonyms FBRSL2; MRD26
Vector pCMV6-Entry
Sequence Data
>RC218943 representing NM_015570
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGCCCGACGCGGGGCCATGGACTCCGCAAAAAGCGGCGGTCGCGGTCGCAGCGAGACCGGGAGA
GGCGCTCCCGGGGCGGGCTGGGGGCCGGCGCGGCCGGCGGCGGCGGGGCTGGCCGGACCCGGGCGCTCTC
ACTCGCCTCGTCGTCGGGCTCCGACAAGGAAGACAATGGGAAGCCCCCGTCCTCCGCCCCGTCCCGGCCC
AGACCCCCGCGGAGGAAGCGGAGAGAGTCCACCTCGGCAGAAGAGGACATCATTGATGGATTTGCCATGA
CCAGCTTTGTCACTTTTGAAGCGCTGGAGAAAGATGTAGCACTTAAGCCTCAGGAACGTGTGGAGAAACG
CCAGACGCCCCTGACCAAGAAGAAACGAGAAGCACTTACCAATGGCTTGTCCTTTCATTCAAAGAAGAGC
AGACTCAGCCACCCACACCACTACAGCTCAGATCGAGAAAATGACCGCAATCTCTGCCAGCACCTTGGGA
AGAGAAAGAAAATGCCGAAGGCACTCAGACAGCTCAAGCCAGGACAGAACAGCTGCAGGGACAGTGACAG
TGAAAGTGCCAGTGGAGAATCCAAGGGCTTCCACCGGAGCAGCTCTCGGGAAAGGCTCAGTGATAGTTCA
GCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATG
CCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACC
AGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAG
AGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCAC
AGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCG
CACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTC
CAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGA
ACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAG
TAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCT
CACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCT
TCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCC
TCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAG
CAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCC
TGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCA
CACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCA
CCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATC
CTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATT
TCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAA
AAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATG
TTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAA
GCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCAC
CACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCC
CTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCC
GTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACA
CCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGA
ACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCG
CAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGAT
GACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGA
ATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAA
GGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAG
GCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCA
AGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCAC
CTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTC
AAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGG
AGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGG
GGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATG
GGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACC
CCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAG
GAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAG
CCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACG
AGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCT
CCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCC
AGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGA
CAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGAC
GACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218943 representing NM_015570
Red=Cloning site Green=Tags(s)

MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNGKPPSSAPSRP
RPPRRKRRESTSAEEDIIDGFAMTSFVTFEALEKDVALKPQERVEKRQTPLTKKKREALTNGLSFHSKKS
RLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQNSCRDSDSESASGESKGFHRSSSRERLSDSS
APSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEK
SQDCCKEPIFEPVVLKDPCPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQL
QPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLSQPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPP
HISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQVAGHPAGSTYSE
QDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPA
PPMFDKYPTKVDPFYRHSLFHSYPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQ
KDPRLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIH
HPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVT
PNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKD
DKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHK
AKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEV
KVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTRMMTPFM
GISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDRE
PHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLP
SMHYPRISPTAGNQNGLLNKTPPTAALSAPPPLISTLGGRPVSPRRTTPLSAEIRERPPSHTLKDIEAR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015570
ORF Size 3777 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015570.1, NM_015570.2, NM_015570.3, NP_056385
RefSeq Size 5972
RefSeq ORF 3780
Locus ID 26053
Cytogenetics 7q11.22
MW 138.8 kDa
Gene Summary This gene has been implicated in neurodevelopment and as a candidate gene for numerous neurological disorders, including autism spectrum disorders, intellectual disability, and developmental delay. Mutations in this gene have also been associated with non-neurological disorders, such as acute lymphoblastic leukemia, aging of the skin, early-onset androgenetic alopecia, and certain cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)