SASH1 (NM_015278) Human Tagged ORF Clone

CAT#: RC218866

Reviews ()
Write a review

SASH1 (Myc-DDK-tagged)-Human SAM and SH3 domain containing 1 (SASH1)



  "NM_015278" in other vectors (6)

Reconstitution Protocol

USD 1,085.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "SASH1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SASH1
Synonyms CAPOK; dJ323M4.1; DUH1; SH3D6A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218866 representing NM_015278
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGACGCGGGAGCAGCTGGCCCGGGGCCGGAGCCTGAGCCCGAGCCCGAGCCGGAGCCCGAGCCCG
CGCCGGAGCCGGAACCGGAGCCCAAGCCGGGTGCTGGCACATCCGAGGCGTTCTCCCGACTCTGGACCGA
CGTGATGGGTATCCTGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTAC
AACACCTGTTTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGG
AAGTGGAGAAACCCGATGCTAGCCCCACGTCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTT
CTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCATAAATCAAACTCAGAAGACAGC
TCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAAAG
GAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGA
GGAGCGGATTCAGCTAATGATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTC
AAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCTGGACCCTGCTGACTGGCCAGATGGTTCTTACC
CAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGAGGAGTCGGTGAA
GTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAA
ATGAAAAAACCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGT
CCGCCCTCTACTCTGGCGTGCACAAGAAGCCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGA
TGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACACCTGGGGGGCTGGCCGGAAGTTG
GTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTTCT
CCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCT
CGGGTCCCTAAGCCACGGGAGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTT
GGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGACTTTGTGTACAAAGAAGTCATCAAATCACCTA
CTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAAGAGAATGTCTAA
AAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCA
CAGCCCGACCCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTT
CTCTCAGTGGGCAGAGCTCCATGAGCGGTCAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGA
AAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGGCCCGTTCTGCGGGCGTGCCAGG
GTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCATCG
ATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTT
CATCTACGTGGACGTGCTCAGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGA
CGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGATCGGATTAACCTAAAAGAGCACATGCCCACTT
TCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTTGGATGAGTTAAA
TATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAAC
AGCGACCAGTCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGCCCTGAGTGGATGCTCACCCCGAG
ACTCAGGATGCTACGAAAGCAGTGAGAACCTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGC
CAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTTGGGCAATTACCCAACATTGCCT
TTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCCAG
ACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTC
CATCTGCCGGAGCTGTGAGACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTG
GATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGTGCCTACCGAGGTGACAGAACCGCCCCCTCAGA
TTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGAGCAAGACTCTGC
TGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAA
CTGGAGGGCTCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATG
CTCAGCCTCCTGGAGCTAAACACGGTTTAGCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTT
TGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGAGCAGAGAATGCAGCCCAAAATT
CCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGTTC
CCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGC
CAGCCCCACCAGCCCTAGCGACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGC
AGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGAGCTCCCCGAGAACACAAGCCTCCAGGAGCACG
GTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCTAGAAACGCTCAC
TGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGT
GGGATTCCTGAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCA
ACATGGACCAGATCCGGGTGAAGCAGCTTCGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCAC
GGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTCAGATTGGCTCATTTCCATCGGT
CTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTCTC
ACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACT
CTTCAAACTGCCGCCAGGCCCTGAGGCCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218866 representing NM_015278
Red=Cloning site Green=Tags(s)

MEDAGAAGPGPEPEPEPEPEPEPAPEPEPEPKPGAGTSEAFSRLWTDVMGILDGSLGNIDDLAQQYADYY
NTCFSDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDS
SVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARL
KEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKLIRVEE
MKKPSTEGGEEHVFENSPVLDERSALYSGVHKKPLFFDGSPEKPPEDDSDSLTTSPSSSSLDTWGAGRKL
VKTFSKGESRGLIKPPKKMGTFFSYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHV
GSNNSDPMGKEGDFVYKEVIKSPTASRISLGKKVKSVKETMRKRMSKKYSSSVSEQDSGLDGMPGSPPPS
QPDPEHLDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRAR
VHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSEDEEKPKRPTRRRRKG
RPPQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDSN
SDQSGSQEKLLVDSQALSGCSPRDSGCYESSENLENGKTRKASLLSAKSSTEPSLKSFSRNQLGNYPTLP
LMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSHSL
DDLQVEPGAEQDVPTEVTEPPPQIVPEVPQKTTASSTKAQPLEQDSAVDNALLLTQSKRFSEPQKLTTKK
LEGSIAASGRGLSPPQCLPRNYDAQPPGAKHGLARTPLEGHRKGHEFEGTHHPLGTKEGVDAEQRMQPKI
PSQPPPVPAKKSRERLANGLHPVPMGPSGALPSPDAPCLPVKRGSPASPTSPSDCPPALAPRPLSGQAPG
SPPSTRPPPWLSELPENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRC
GIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVSPGCISSVSDWLISIG
LPMYAGTLSTAGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLPPGPEAM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015278
ORF Size 3741 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015278.5
RefSeq Size 7709 bp
RefSeq ORF 3744 bp
Locus ID 23328
UniProt ID O94885
Cytogenetics 6q24.3-q25.1
Domains SH3, SAM
MW 136.5 kDa
Gene Summary This gene encodes a scaffold protein involved in the TLR4 signaling pathway that may stimulate cytokine production and endothelial cell migration in response to invading pathogens. The encoded protein has also been described as a potential tumor suppressor that may negatively regulate proliferation, apoptosis, and invasion of cancer cells, and reduced expression of this gene has been observed in multiple human cancers. Mutations in this gene may be associated with abnormal skin pigmentation in human patients. [provided by RefSeq, Oct 2016]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.