Eg5 (KIF11) (NM_004523) Human Tagged ORF Clone

CAT#: RC218842

Reviews ()
Write a review

KIF11 (Myc-DDK-tagged)-Human kinesin family member 11 (KIF11)



  "NM_004523" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 919.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "KIF11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KIF11
Synonyms EG5; HKSP; KNSL1; MCLMR; TRIP5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218842 representing NM_004523
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCGCAGCCAAATTCGTCTGCGAAGAAGAAAGAGGAGAAGGGGAAGAACATCCAGGTGGTGGTGA
GATGCAGACCATTTAATTTGGCAGAGCGGAAAGCTAGCGCCCATTCAATAGTAGAATGTGATCCTGTACG
AAAAGAAGTTAGTGTACGAACTGGAGGATTGGCTGACAAGAGCTCAAGGAAAACATACACTTTTGATATG
GTGTTTGGAGCATCTACTAAACAGATTGATGTTTACCGAAGTGTTGTTTGTCCAATTCTGGATGAAGTTA
TTATGGGCTATAATTGCACTATCTTTGCGTATGGCCAAACTGGCACTGGAAAAACTTTTACAATGGAAGG
TGAAAGGTCACCTAATGAAGAGTATACCTGGGAAGAGGATCCCTTGGCTGGTATAATTCCACGTACCCTT
CATCAAATTTTTGAGAAACTTACTGATAATGGTACTGAATTTTCAGTCAAAGTGTCTCTGTTGGAGATCT
ATAATGAAGAGCTTTTTGATCTTCTTAATCCATCATCTGATGTTTCTGAGAGACTACAGATGTTTGATGA
TCCCCGTAACAAGAGAGGAGTGATAATTAAAGGTTTAGAAGAAATTACAGTACACAACAAGGATGAAGTC
TATCAAATTTTAGAAAAGGGGGCAGCAAAAAGGACAACTGCAGCTACTCTGATGAATGCATACTCTAGTC
GTTCCCACTCAGTTTTCTCTGTTACAATACATATGAAAGAAACTACGATTGATGGAGAAGAGCTTGTTAA
AATCGGAAAGTTGAACTTGGTTGATCTTGCAGGAAGTGAAAACATTGGCCGTTCTGGAGCTGTTGATAAG
AGAGCTCGGGAAGCTGGAAATATAAATCAATCCCTGTTGACTTTGGGAAGGGTCATTACTGCCCTTGTAG
AAAGAACACCTCATGTTCCTTATCGAGAATCTAAACTAACTAGAATCCTCCAGGATTCTCTTGGAGGGCG
TACAAGAACATCTATAATTGCAACAATTTCTCCTGCATCTCTCAATCTTGAGGAAACTCTGAGTACATTG
GAATATGCTCATAGAGCAAAGAACATATTGAATAAGCCTGAAGTGAATCAGAAACTCACCAAAAAAGCTC
TTATTAAGGAGTATACGGAGGAGATAGAACGTTTAAAACGAGATCTTGCTGCAGCCCGTGAGAAAAATGG
AGTGTATATTTCTGAAGAAAATTTTAGAGTCATGAGTGGAAAATTAACTGTTCAAGAAGAGCAGATTGTA
GAATTGATTGAAAAAATTGGTGCTGTTGAGGAGGAGCTGAATAGGGTTACAGAGTTGTTTATGGATAATA
AAAATGAACTTGACCAGTGTAAATCTGACCTGCAAAATAAAACACAAGAACTTGAAACCACTCAAAAACA
TTTGCAAGAAACTAAATTACAACTTGTTAAAGAAGAATATATCACATCAGCTTTGGAAAGTACTGAGGAG
AAACTTCATGATGCTGCCAGCAAGCTGCTTAACACAGTTGAAGAAACTACAAAAGATGTATCTGGTCTCC
ATTCCAAACTGGATCGTAAGAAGGCAGTTGACCAACACAATGCAGAAGCTCAGGATATTTTTGGCAAAAA
CCTGAATAGTCTGTTTAATAATATGGAAGAATTAATTAAGGATGGCAGCTCAAAGCAAAAGGCCATGCTA
GAAGTACATAAGACCTTATTTGGTAATCTGCTGTCTTCCAGTGTCTCTGCATTAGATACCATTACTACAG
TAGCACTTGGATCTCTCACATCTATTCCAGAAAATGTGTCTACTCATGTTTCTCAGATTTTTAATATGAT
ACTAAAAGAACAATCATTAGCAGCAGAAAGTAAAACTGTACTACAGGAATTGATTAATGTACTCAAGACT
GATCTTCTAAGTTCACTGGAAATGATTTTATCCCCAACTGTGGTGTCTATACTGAAAATCAATAGTCAAC
TAAAGCATATTTTCAAGACTTCATTGACAGTGGCCGATAAGATAGAAGATCAAAAAAAGGAACTAGATGG
CTTTCTCAGTATACTGTGTAACAATCTACATGAACTACAAGAAAATACCATTTGTTCCTTGGTTGAGTCA
CAAAAGCAATGTGGAAACCTAACTGAAGACCTGAAGACAATAAAGCAGACCCATTCCCAGGAACTTTGCA
AGTTAATGAATCTTTGGACAGAGAGATTCTGTGCTTTGGAGGAAAAGTGTGAAAATATACAGAAACCACT
TAGTAGTGTCCAGGAAAATATACAGCAGAAATCTAAGGATATAGTCAACAAAATGACTTTTCACAGTCAA
AAATTTTGTGCTGATTCTGATGGCTTCTCACAGGAACTCAGAAATTTTAACCAAGAAGGTACAAAATTGG
TTGAAGAATCTGTGAAACACTCTGATAAACTCAATGGCAACCTGGAAAAAATATCTCAAGAGACTGAACA
GAGATGTGAATCTCTGAACACAAGAACAGTTTATTTTTCTGAACAGTGGGTATCTTCCTTAAATGAAAGG
GAACAGGAACTTCACAACTTATTGGAGGTTGTAAGCCAATGTTGTGAGGCTTCAAGTTCAGACATCACTG
AGAAATCAGATGGACGTAAGGCAGCTCATGAGAAACAGCATAACATTTTTCTTGATCAGATGACTATTGA
TGAAGATAAATTGATAGCACAAAATCTAGAACTTAATGAAACCATAAAAATTGGTTTGACTAAGCTTAAT
TGCTTTCTGGAACAGGATCTGAAACTGGATATCCCAACAGGTACGACACCACAGAGGAAAAGTTATTTAT
ACCCATCAACACTGGTAAGAACTGAACCACGTGAACATCTCCTTGATCAGCTGAAAAGGAAACAGCCTGA
GCTGTTAATGATGCTAAACTGTTCAGAAAACAACAAAGAAGAGACAATTCCGGATGTGGATGTAGAAGAG
GCAGTTCTGGGGCAGTATACTGAAGAACCTCTAAGTCAAGAGCCATCTGTAGATGCTGGTGTGGATTGTT
CATCAATTGGCGGGGTTCCATTTTTCCAGCATAAAAAATCACATGGAAAAGACAAAGAAAACAGAGGCAT
TAACACACTGGAGAGGTCTAAAGTGGAAGAAACTACAGAGCACTTGGTTACAAAGAGCAGATTACCTCTG
CGAGCCCAGATCAACCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218842 representing NM_004523
Red=Cloning site Green=Tags(s)

MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKSSRKTYTFDM
VFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGIIPRTL
HQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDEV
YQILEKGAAKRTTAATLMNAYSSRSHSVFSVTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDK
RAREAGNINQSLLTLGRVITALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTL
EYAHRAKNILNKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEYITSALESTEE
KLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNSLFNNMEELIKDGSSKQKAML
EVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHVSQIFNMILKEQSLAAESKTVLQELINVLKT
DLLSSLEMILSPTVVSILKINSQLKHIFKTSLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVES
QKQCGNLTEDLKTIKQTHSQELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQ
KFCADSDGFSQELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNETIKIGLTKLN
CFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLMMLNCSENNKEETIPDVDVEE
AVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGKDKENRGINTLERSKVEETTEHLVTKSRLPL
RAQINL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004523
ORF Size 3168 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004523.4
RefSeq Size 4908 bp
RefSeq ORF 3171 bp
Locus ID 3832
UniProt ID P52732
Cytogenetics 10q23.33
Domains kinesin
Protein Families Druggable Genome
MW 119 kDa
Gene Summary This gene encodes a motor protein that belongs to the kinesin-like protein family. Members of this protein family are known to be involved in various kinds of spindle dynamics. The function of this gene product includes chromosome positioning, centrosome separation and establishing a bipolar spindle during cell mitosis. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.