RRBP1 (NM_001042576) Human Tagged ORF Clone

CAT#: RC218816

Reviews ()
Write a review

RRBP1 (Myc-DDK-tagged)-Human ribosome binding protein 1 homolog 180kDa (dog) (RRBP1), transcript variant 1



Reconstitution Protocol

USD 1,341.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RRBP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RRBP1
Synonyms ES/130; ES130; hES; p180; RRp
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218816 representing NM_001042576
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATATTTACGACACTCAAACCTTGGGGGTTGTGGTCTTTGGAGGATTCATGGTTGTTTCTGCCATTG
GCATCTTCCTGGTGTCGACTTTCTCCATGAAGGAAACGTCATATGAAGAAGCCCTAGCCAACCAGCGCAA
GGAGATGGCGAAAACTCACCACCAGAAAGTCGAGAAGAAAAAGAAGGAGAAAACAGTGGAGAAGAAAGGA
AAGACCAAGAAAAAGGAAGAGAAACCTAATGGGAAGATACCTGATCATGATCCAGCCCCCAATGTGACTG
TCCTCCTTCGAGAACCAGTGCGGGCTCCTGCTGTGGCTGTGGCTCCAACCCCAGTGCAGCCCCCCATTAT
CGTTGCTCCTGTCGCCACAGTTCCAGCCATGCCCCAGGAGAAGCTGGCCTCCTCCCCCAAGGACAAAAAG
AAGAAGGAGAAAAAAGTGGCAAAAGTGGAACCAGCTGTCAGCTCTGTAGTGAATTCCATCCAGGTTCTCA
CTTCGAAGGCTGCCATCTTGGAAACTGCTCCCAAGGAGGGCAGAAATACAGATGTGGCCCAGAGCCCAGA
GGCACCAAAGCAAGAGGCTCCTGCCAAGAAGAAGTCTGGTTCAAAGAAAAAAGGGCCCCCAGATGCCGAC
GGCCCTCTCTACCTCCCCTACAAGACGCTGGTCTCCACGGTTGGGAGCATGGTGTTCAACGAGGGCGAGG
CCCAGCGGCTCATCGAGATCCTGTCTGAGAAGGCTGGCATCATTCAGGACACCTGGCACAAGGCCACTCA
GAAGGGTGACCCTGTGGCGATTCTGAAACGCCAGCTGGAAGAGAAGGAAAAACTGCTGGCCACAGAACAG
GAAGATGCGGCTGTCGCCAAGAGCAAACTGAGGGAGCTCAACAAGGAGATGGCAGCAGAAAAGGCCAAAG
CAGCAGCCGGGGAGGCCAAAGTGAAAAAGCAGCTGGTGGCCCGGGAGCAGGAGATCACGGCTGTGCAGGC
ACGCATGCAGGCCAGCTACCGGGAGCACGTGAAGGAGGTGCAGCAGCTGCAGGGCAAGATCCGGACTCTT
CAGGAGCAGCTGGAGAATGGCCCCAACACGCAGCTGGCCCGCCTGCAGCAGGAGAACTCCATCCTGCGGG
ATGCCTTGAACCAGGCCACGAGCCAGGTGGAGAGCAAGCAGAACGCAGAGCTGGCCAAGCTTCGGCAGGA
GCTCAGCAAGGTCAGCAAAGAGCTGGTGGAGAAGTCAGAGGCTGTGCGGCAAGATGAGCAGCAGCGGAAA
GCTCTGGAAGCCAAGGCAGCTGCCTTCGAGAAGCAGGTCCTGCAGCTGCAGGCGTCCCACAGGGAGAGTG
AGGAGGCCCTGCAGAAGCGCCTGGACGAGGTCAGCCGGGAGCTGTGCCACACGCAGAGCAGCCACGCCAG
CCTCCGGGCGGATGCCGAGAAGGCCCAGGAGCAACAGCAGCAGATGGCCGAGCTGCACAGCAAGTTACAG
TCCTCCGAGGCGGAGGTGCGCAGCAAATGCGAGGAGCTGAGTGGCCTCCACGGGCAGCTCCAGGAGGCCA
GGGCGGAGAACTCCCAGCTCACAGAGAGAATCCGTTCCATTGAGGCCCTGCTGGAGGCGGGCCAGGCGCG
GGATGCCCAGGACGTCCAGGCCAGCCAGGCGGAGGCTGACCAGCAGCAGACTCGCCTCAAGGAGCTGGAG
TCCCAGGTGTCGGGTCTGGAGAAGGAGGCCATCGAGCTCAGGGAGGCCGTCGAGCAGCAGAAAGTGAAGA
ACAATGACCTCCGGGAGAAGAACTGGAAGGCCATGGAGGCACTGGCCACGGCCGAGCAGGCCTGCAAGGA
GAAGCTGCACTCCCTGACCCAGGCCAAGGAGGAATCGGAGAAGCAGCTCTGTCTGATTGAGGCGCAGACC
ATGGAGGCCCTGCTGGCTCTGCTCCCAGAACTCTCTGTCTTGGCACAACAGAATTACACCGAGTGGCTGC
AGGATCTCAAAGAGAAAGGCCCCACGCTGCTGAAGCACCCGCCAGCTCCCGCGGAGCCCTCCTCGGACCT
GGCCTCCAAGTTGAGGGAGGCCGAGGAGACGCAGAGCACACTGCAGGCCGAGTGTGACCAGTACCGCAGC
ATCCTGGCGGAGACGGAGGGCATGCTCAGAGACCTGCAGAAGAGCGTGGAGGAGGAGGAGCAGGTGTGGA
GGGCCAAGGTGGGCGCCGCAGAGGAGGAGCTCCAGAAGTCCCGGGTCACAGTGAAGCATCTCGAAGAGAT
TGTAGAGAAGCTAAAAGGAGAACTTGAAAGTTCGGACCAGGTGAGGGAGCACACGTCGCATTTGGAGGCA
GAGCTGGAAAAGCACATGGCGGCCGCCAGCGCCGAGTGCCAGAACTACGCCAAGGAGGTGGCAGGGCTGA
GGCAACTTCTCCTAGAATCTCAATCTCAGCTCGATGCCGCCAAGAGCGAAGCCCAGAAACAGAGCGATGA
GCTTGCCCTGGTCAGGCAGCAGTTGAGTGAAATGAAGAGCCACGTAGAGGATGGTGACATAGCTGGGGCC
CCAGCTTCCTCCCCAGAGGCGCCCCCAGCCGAGCAGGACCCCGTTCAGCTGAAGACGCAGCTGGAGTGGA
CAGAAGCCATCCTGGAGGATGAGCAGACACAGCGGCAGAAGCTCACGGCCGAGTTTGAGGAGGCTCAGAC
CTCGGCATGTCGGTTACAAGAAGAATTGGAGAAGCTCCGCACAGCCGGCCCCCTAGAGTCTTCAGAAACA
GAGGAGGCCTCACAGCTGAAGGAGAGACTAGAAAAAGAGAAGAAGTTAACAAGTGACCTGGGGCGCGCCG
CCACGAGACTGCAGGAGCTTCTGAAGACGACCCAGGAGCAGCTGGCAAGGGAGAAGGACACGGTGAAGAA
GCTGCAGGAACAGCTGGAAAAGGCAGAGGACGGCAGCAGCTCAAAGGAGGGCACCTCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218816 representing NM_001042576
Red=Cloning site Green=Tags(s)

MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKG
KTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAPVATVPAMPQEKLASSPKDKK
KKEKKVAKVEPAVSSVVNSIQVLTSKAAILETAPKEGRNTDVAQSPEAPKQEAPAKKKSGSKKKGPPDAD
GPLYLPYKTLVSTVGSMVFNEGEAQRLIEILSEKAGIIQDTWHKATQKGDPVAILKRQLEEKEKLLATEQ
EDAAVAKSKLRELNKEMAAEKAKAAAGEAKVKKQLVAREQEITAVQARMQASYREHVKEVQQLQGKIRTL
QEQLENGPNTQLARLQQENSILRDALNQATSQVESKQNAELAKLRQELSKVSKELVEKSEAVRQDEQQRK
ALEAKAAAFEKQVLQLQASHRESEEALQKRLDEVSRELCHTQSSHASLRADAEKAQEQQQQMAELHSKLQ
SSEAEVRSKCEELSGLHGQLQEARAENSQLTERIRSIEALLEAGQARDAQDVQASQAEADQQQTRLKELE
SQVSGLEKEAIELREAVEQQKVKNNDLREKNWKAMEALATAEQACKEKLHSLTQAKEESEKQLCLIEAQT
MEALLALLPELSVLAQQNYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRS
ILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEIVEKLKGELESSDQVREHTSHLEA
ELEKHMAAASAECQNYAKEVAGLRQLLLESQSQLDAAKSEAQKQSDELALVRQQLSEMKSHVEDGDIAGA
PASSPEAPPAEQDPVQLKTQLEWTEAILEDEQTQRQKLTAEFEEAQTSACRLQEELEKLRTAGPLESSET
EEASQLKERLEKEKKLTSDLGRAATRLQELLKTTQEQLAREKDTVKKLQEQLEKAEDGSSSKEGTSV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001042576
ORF Size 2931 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001042576.1, NP_001036041.1
RefSeq Size 3792 bp
RefSeq ORF 2934 bp
Locus ID 6238
UniProt ID Q9P2E9
Cytogenetics 20p12.1
Protein Families Druggable Genome, Transmembrane
MW 108.5 kDa
Gene Summary This gene encodes a ribosome-binding protein of the endoplasmic reticulum (ER) membrane. Studies suggest that this gene plays a role in ER proliferation, secretory pathways and secretory cell differentiation, and mediation of ER-microtubule interactions. Alternative splicing has been observed and protein isoforms are characterized by regions of N-terminal decapeptide and C-terminal heptad repeats. Splicing of the tandem repeats results in variations in ribosome-binding affinity and secretory function. The full-length nature of variants which differ in repeat length has not been determined. Pseudogenes of this gene have been identified on chromosomes 3 and 7, and RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome, the result of a mutation in a nearby gene on chromosome 20p12. [provided by RefSeq, Apr 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.