Integrin alpha 9 (ITGA9) (NM_002207) Human Tagged ORF Clone

CAT#: RC218815

ITGA9 (Myc-DDK-tagged)-Human integrin, alpha 9 (ITGA9)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_002207" in other vectors (6)

Reconstitution Protocol

USD 901.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


ITGA9 Antibody - C-terminal region
    • 100 ul

USD 539.00

Other products for "Integrin alpha 9"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Integrin alpha 9
Synonyms ALPHA-RLC; ITGA4L; RLC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218815 representing NM_002207
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGG
GGATCCCCGCGGGCGCCTACAACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTT
CTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGTGGGCGCACCAAAGGCA
GATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTG
ACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCG
GGAAGACCGCGATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTG
GCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACA
TCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGAGTATAAGAAGAAGTA
CGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGT
GCTCCAGGGTCATTTTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAAC
TGAACGACGAAGTGATCATGAACAGGCGGTACACCTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTC
TCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAGGACAAAGGCATCGGCAAGGTTTATATTTTC
AGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATGGGCTCTTACT
TCGGCTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCAT
GTTTTCTGAGATCAGGGATGAGGGACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAG
CAGCTGGCTCTGACTGGGGATGGTGCCTACAATGCGCACTTTGGAGAGAGCATTGCCAGCCTGGACGATC
TGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGATGACTTCGCAGGGGCGGTCTA
TATCTATCATGGTGATGCCAGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAAT
CCAGTGCTCCGGATGTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATG
TCACTGTTGGAGCCTTCATGTCCGACAGCGTGGTTCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGT
CTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCTCAGTGTCACGACGGACAGCAGCCTGTGAAC
TGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGCCTGAATTATG
TTCTGATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGA
GACCATGGGTCAGGTCACAGAGAAGCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCC
CATGTGAAGCGGAGGGTGCAGGACGTCATCAGCCCGATCGTGTTTGAAGCAGCCTACAGCCTCAGTGAGC
ATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTCCGCTGGAAAAAGGGACAAAA
GATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAG
CTTCAGGGTAAACTGCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGA
ACATCTCCCTAAACATCTCTATCTCCAACCTCGGAGATGATGCCTATGATGCCAACGTGTCCTTCAATGT
TTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAGGAGATGGGCATCTCCTGTGAGCTGCTGGAA
TCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAATTCAGCGTGA
TCTTTGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAA
CACGGAGCGCTCTGAATCCCTGCATGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGAC
ACGTCCATCACCGGAATCATGTCTCCAACCTCCTTTGTATATGGCGAGTCCGTGGACGCAGCCAACTTCA
TTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTTCAGGTCTACAACACTGGCCC
AAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATG
TTTCATGTCCAGGAAATGGTGGTGGGCCAAGAGAAGGGAAACTGCTCTTTCCAGAAAAACCCAACTCCCT
GCATCATCCCTCAAGAACAAGAAAATATCTTCCACACAATATTTGCTTTTTTCACAAAGTCTGGAAGAAA
AGTCTTGGACTGTGAAAAACCAGGAATTTCTTGCCTAACAGCACACTGTAACTTTAGTGCTCTTGCTAAA
GAAGAAAGTCGTACTATAGACATTTACATGCTGCTGAACACAGAAATACTGAAAAAGGACAGTTCGTCTG
TCATCCAGTTCATGTCCCGCGCCAAGGTGAAGGTGGATCCTGCCCTAAGGGTGGTGGAAATAGCTCATGG
GAACCCAGAAGAGGTGACGGTGGTCTTCGAGGCCCTGCACAATCTGGAGCCCCGTGGCTACGTCGTGGGG
TGGATCATCGCCATCAGTTTGTTGGTGGGAATCCTCATCTTCCTGCTGCTGGCCGTGCTGCTCTGGAAGA
TGGGCTTCTTTCGCCGAAGGTACAAAGAAATTATCGAAGCTGAGAAGAACCGGAAAGAGAATGAAGACAG
TTGGGACTGGGTCCAGAAAAACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218815 representing NM_002207
Red=Cloning site Green=Tags(s)

MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKA
DSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVL
ACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMG
APGSFYWAGTIKVLNLTDNTYLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIF
RADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEE
QLALTGDGAYNAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDASGIVPQYSMKLSGQKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVN
CLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVA
HVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ
LQGKLLLSSMDEKTLYLALGAVKNISLNISISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLE
SDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVD
TSITGIMSPTSFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLTAHCNFSALAK
EESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPEEVTVVFEALHNLEPRGYVVG
WIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKNQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002207
ORF Size 3105 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002207.3
RefSeq Size 3962 bp
RefSeq ORF 3108 bp
Locus ID 3680
UniProt ID Q13797
Cytogenetics 3p22.2
Domains FG-GAP
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cell adhesion molecules (CAMs), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Regulation of actin cytoskeleton
MW 114.52 kDa
Gene Summary This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain, forms an integrin that is a receptor for VCAM1, cytotactin and osteopontin. Expression of this gene has been found to be upregulated in small cell lung cancers. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.