Growth hormone receptor (GHR) (NM_000163) Human Tagged ORF Clone

CAT#: RC218710

Reviews ()
Write a review
  • TrueORF®

GHR (Myc-DDK-tagged)-Human growth hormone receptor (GHR)



Reconstitution Protocol

USD 891.00

USD 1,336.00

3 Weeks*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GHR
Synonyms GHBP; GHIP
Vector pCMV6-AC-Myc-DDK
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218710 representing NM_000163.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGATCTCTGGCAGCTGCTGTTGACCTTGGCACTGGCAGGATCAAGTGATGCTTTTTCTGGAAGTGAG
GCCACAGCAGCTATCCTTAGCAGAGCACCCTGGAGTCTGCAAAGTGTTAATCCAGGCCTAAAGACAAAT
TCTTCTAAGGAGCCTAAATTCACCAAGTGCCGTTCACCTGAGCGAGAGACTTTTTCATGCCACTGGACA
GATGAGGTTCATCATGGTACAAAGAACCTAGGACCCATACAGCTGTTCTATACCAGAAGGAACACTCAA
GAATGGACTCAAGAATGGAAAGAATGCCCTGATTATGTTTCTGCTGGGGAAAACAGCTGTTACTTTAAT
TCATCGTTTACCTCCATCTGGATACCTTATTGTATCAAGCTAACTAGCAATGGTGGTACAGTGGATGAA
AAGTGTTTCTCTGTTGATGAAATAGTGCAACCAGATCCACCCATTGCCCTCAACTGGACTTTACTGAAC
GTCAGTTTAACTGGGATTCATGCAGATATCCAAGTGAGATGGGAAGCACCACGCAATGCAGATATTCAG
AAAGGGTGGATGGTTCTGGAGTATGAACTTCAATACAAAGAAGTAAATGAAACTAAATGGAAAATGATG
GACCCTATATTGACAACATCAGTTCCAGTGTACTCATTGAAAGTGGATAAGGAATATGAAGTGCGTGTG
AGATCCAAACAACGAAACTCTGGAAATTATGGCGAGTTCAGTGAGGTGCTCTATGTAACACTTCCTCAG
ATGAGCCAATTTACATGTGAAGAAGATTTCTACTTTCCATGGCTCTTAATTATTATCTTTGGAATATTT
GGGCTAACAGTGATGCTATTTGTATTCTTATTTTCTAAACAGCAAAGGATTAAAATGCTGATTCTGCCC
CCAGTTCCAGTTCCAAAGATTAAAGGAATCGATCCAGATCTCCTCAAGGAAGGAAAATTAGAGGAGGTG
AACACAATCTTAGCCATTCATGATAGCTATAAACCCGAATTCCACAGTGATGACTCTTGGGTTGAATTT
ATTGAGCTAGATATTGATGAGCCAGATGAAAAGACTGAGGAATCAGACACAGACAGACTTCTAAGCAGT
GACCATGAGAAATCACATAGTAACCTAGGGGTGAAGGATGGCGACTCTGGACGTACCAGCTGTTGTGAA
CCTGACATTCTGGAGACTGATTTCAATGCCAATGACATACATGAGGGTACCTCAGAGGTTGCTCAGCCA
CAGAGGTTAAAAGGGGAAGCAGATCTCTTATGCCTTGACCAGAAGAATCAAAATAACTCACCTTATCAT
GATGCTTGCCCTGCTACTCAGCAGCCCAGTGTTATCCAAGCAGAGAAAAACAAACCACAACCACTTCCT
ACTGAAGGAGCTGAGTCAACTCACCAAGCTGCCCATATTCAGCTAAGCAATCCAAGTTCACTGTCAAAC
ATCGACTTTTATGCCCAGGTGAGCGACATTACACCAGCAGGTAGCGTGGTCCTTTCCCCGGGCCAAAAG
AATAAGGCAGGGATGTCCCAATGTGACATGCACCCGGAAATGGTCTCACTCTGCCAAGAAAACTTCCTT
ATGGACAATGCCTACTTCTGTGAGGCAGATGCCAAAAAGTGCATCCCTGTGGCTCCTCACATCAAGGTT
GAATCACACATACAGCCAAGCTTAAACCAAGAGGACATTTACATCACCACAGAAAGCCTTACCACTGCT
GCTGGGAGGCCTGGGACAGGAGAACATGTTCCAGGTTCTGAGATGCCTGTCCCAGACTATACCTCCATT
CATATAGTACAGTCCCCACAGGGCCTCATACTCAATGCGACTGCCTTGCCCTTGCCTGACAAAGAGTTT
CTCTCATCATGTGGCTATGTGAGCACAGACCAACTGAACAAAATCATGCCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC218710
Blue=ORF Red=Cloning site Green=Tag(s)

MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWT
DEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDE
KCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMM
DPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIF
GLTVMLFVFLFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEF
IELDIDEPDEKTEESDTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQP
QRLKGEADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSSLSN
IDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADAKKCIPVAPHIKV
ESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHIVQSPQGLILNATALPLPDKEF
LSSCGYVSTDQLNKIMP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000163
ORF Size 1914 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 4370 bp
RefSeq ORF 1917 bp
Locus ID 2690
UniProt ID P10912
Cytogenetics 5p13.1-p12
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction
MW 71.5 kDa
Gene Summary This gene encodes a member of the type I cytokine receptor family, which is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. In humans and rabbits, but not rodents, growth hormone binding protein (GHBP) is generated by proteolytic cleavage of the extracellular ligand-binding domain from the mature growth hormone receptor protein. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.