GPRC6A (NM_148963) Human Tagged ORF Clone

CAT#: RC218656

GPRC6A (Myc-DDK-tagged)-Human G protein-coupled receptor, family C, group 6, member A (GPRC6A)

Need custom modification / cloning service?
Get a free quote

USD 1,422.00


Availability*
In Stock

Size
    • 10 ug

Cited in 3 publications.

Product images

Specifications

Product Data
Product Name GPRC6A (NM_148963) Human Tagged ORF Clone
Symbol GPRC6A
Synonyms bA86F4.3; GPCR
Vector pCMV6-Entry
Sequence Data
>RC218656 representing NM_148963
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATTCTTAATTATACTAATTACCTGCTTTGTGATTATTCTTGCTACTTCACAGCCTTGCCAGACCC
CTGATGACTTTGTGGCTGCCACTTCTCCGGGACATATCATAATTGGAGGTTTGTTTGCTATTCATGAAAA
AATGTTGTCCTCAGAAGACTCTCCCAGACGACCACAAATCCAGGAGTGTGTTGGCTTTGAAATATCAGTT
TTTCTTCAAACTCTTGCCATGATACACAGCATTGAGATGATCAACAATTCAACACTCTTATCTGGAGTCA
AACTGGGGTATGAAATCTATGACACTTGTACAGAAGTCACAGTGGCAATGGCAGCCACTCTGAGGTTTCT
TTCTAAATTCAACTGCTCCAGAGAAACTGTGGAGTTTAAGTGTGACTATTCCAGCTACATGCCAAGAGTT
AAGGCTGTCATAGGTTCTGGGTACTCAGAAATAACTATGGCTGTCTCCAGGATGTTGAATTTACAGCTCA
TGCCACAGGTGGGTTATGAATCAACTGCAGAAATCCTGAGTGACAAAATTCGCTTTCCTTCATTTTTACG
GACTGTGCCCAGTGACTTCCATCAAATTAAAGCAATGGCTCACCTGATTCAGAAATCTGGTTGGAACTGG
ATTGGCATCATAACCACAGATGATGACTATGGACGATTGGCTCTTAACACTTTTATAATTCAGGCTGAAG
CAAATAACGTGTGCATAGCCTTCAAAGAGGTTCTTCCAGCCTTTCTTTCAGATAATACCATTGAAGTCAG
AATCAATCGGACACTGAAGAAAATCATTTTAGAAGCCCAGGTTAATGTCATTGTGGTATTTCTGAGGCAA
TTCCATGTTTTTGATCTCTTCAATAAAGCCATTGAAATGAATATAAATAAGATGTGGATTGCTAGTGATA
ATTGGTCAACTGCCACCAAGATTACCACCATTCCTAATGTTAAAAAGATTGGCAAAGTTGTAGGGTTTGC
CTTTAGAAGAGGGAATATATCCTCTTTCCATTCCTTTCTTCAAAATCTGCACTTGCTTCCCAGTGACAGT
CACAAACTCTTACATGAATATGCCATGCATTTATCTGCCTGCGCATATGTCAAGGACACTGATTTGAGTC
AATGCATATTCAATCATTCTCAAAGGACTTTGGCCTACAAGGCTAACAAGGCTATAGAAAGGAACTTCGT
CATGAGAAATGACTTCCTCTGGGACTATGCTGAGCCAGGACTCATTCATAGTATTCAGCTTGCAGTGTTT
GCCCTTGGTTATGCCATTCGGGATCTGTGTCAAGCTCGTGACTGTCAGAACCCCAACGCCTTTCAACCAT
GGGAGTTACTTGGTGTGCTAAAAAATGTGACATTCACTGATGGATGGAATTCATTTCATTTTGATGCTCA
TGGGGATTTAAATACTGGATATGATGTTGTGCTCTGGAAGGAGATCAATGGACACATGACTGTCACTAAG
ATGGCAGAATATGACCTACAGAATGATGTCTTCATCATCCCAGATCAGGAAACAAAAAATGAGTTCAGGA
ATCTTAAGCAAATTCAATCTAAATGCTCCAAGGAATGCAGTCCTGGGCAAATGAAGAAAACTACAAGAAG
TCAACACATCTGTTGCTATGAATGTCAGAACTGTCCTGAAAATCATTACACTAATCAGACAGATATGCCT
CATTGCCTTTTATGCAACAACAAAACTCACTGGGCCCCTGTTAGGAGCACTATGTGCTTTGAAAAGGAAG
TGGAATATCTCAACTGGAATGACTCCTTGGCCATCCTACTCCTGATTCTCTCCCTACTGGGAATCATATT
TGTTCTGGTTGTTGGCATAATATTTACAAGAAACCTGAACACTCCTGTTGTGAAATCATCCGGGGGATTA
AGAGTCTGCTATGTGATCCTTCTCTGTCATTTCCTCAATTTTGCCAGCACGAGCTTTTTCATTGGAGAAC
CACAAGACTTCACATGTAAAACCAGGCAGACAATGTTTGGAGTGAGCTTTACTCTTTGCATCTCCTGCAT
TTTGACGAAGTCTCTGAAAATTTTGCTAGCTTTCAGCTTTGATCCCAAATTACAGAAATTTCTGAAGTGC
CTCTATAGACCGATCCTTATTATCTTCACTTGCACGGGCATCCAGGTTGTCATTTGCACACTCTGGCTAA
TCTTTGCAGCACCTACTGTAGAGGTGAATGTCTCCTTGCCCAGAGTCATCATCCTGGAGTGTGAGGAGGG
ATCCATACTTGCATTTGGCACCATGCTGGGCTACATTGCCATCCTGGCCTTCATTTGCTTCATATTTGCT
TTCAAAGGCAAATATGAGAATTACAATGAAGCCAAATTCATTACATTTGGCATGCTCATTTACTTCATAG
CTTGGATCACATTCATCCCTATCTATGCTACCACATTTGGCAAATATGTACCGGCTGTGGAGATTATTGT
CATATTAATATCTAACTATGGAATCCTGTATTGCACATTCATCCCCAAATGCTATGTTATTATTTGTAAG
CAAGAGATTAACACAAAGTCTGCCTTTCTCAAGATGATCTACAGTTATTCTTCCCATAGTGTGAGCAGCA
TTGCCCTGAGTCCTGCTTCACTGGACTCCATGAGCGGCAATGTCACAATGACCAATCCCAGCTCTAGTGG
CAAGTCTGCAACCTGGCAGAAAAGCAAAGATCTTCAGGCACAAGCATTTGCACACATATGCAGGGAAAAT
GCCACAAGTGTATCTAAAACTTTGCCTCGAAAAAGAATGTCAAGTATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218656 representing NM_148963
Red=Cloning site Green=Tags(s)

MAFLIILITCFVIILATSQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFEISV
FLQTLAMIHSIEMINNSTLLSGVKLGYEIYDTCTEVTVAMAATLRFLSKFNCSRETVEFKCDYSSYMPRV
KAVIGSGYSEITMAVSRMLNLQLMPQVGYESTAEILSDKIRFPSFLRTVPSDFHQIKAMAHLIQKSGWNW
IGIITTDDDYGRLALNTFIIQAEANNVCIAFKEVLPAFLSDNTIEVRINRTLKKIILEAQVNVIVVFLRQ
FHVFDLFNKAIEMNINKMWIASDNWSTATKITTIPNVKKIGKVVGFAFRRGNISSFHSFLQNLHLLPSDS
HKLLHEYAMHLSACAYVKDTDLSQCIFNHSQRTLAYKANKAIERNFVMRNDFLWDYAEPGLIHSIQLAVF
ALGYAIRDLCQARDCQNPNAFQPWELLGVLKNVTFTDGWNSFHFDAHGDLNTGYDVVLWKEINGHMTVTK
MAEYDLQNDVFIIPDQETKNEFRNLKQIQSKCSKECSPGQMKKTTRSQHICCYECQNCPENHYTNQTDMP
HCLLCNNKTHWAPVRSTMCFEKEVEYLNWNDSLAILLLILSLLGIIFVLVVGIIFTRNLNTPVVKSSGGL
RVCYVILLCHFLNFASTSFFIGEPQDFTCKTRQTMFGVSFTLCISCILTKSLKILLAFSFDPKLQKFLKC
LYRPILIIFTCTGIQVVICTLWLIFAAPTVEVNVSLPRVIILECEEGSILAFGTMLGYIAILAFICFIFA
FKGKYENYNEAKFITFGMLIYFIAWITFIPIYATTFGKYVPAVEIIVILISNYGILYCTFIPKCYVIICK
QEINTKSAFLKMIYSYSSHSVSSIALSPASLDSMSGNVTMTNPSSSGKSATWQKSKDLQAQAFAHICREN
ATSVSKTLPRKRMSSI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_148963
ORF Size 2778 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_148963.1, NM_148963.2, NM_148963.3, NP_683766
RefSeq Size 2860
RefSeq ORF 2781
Locus ID 222545
Cytogenetics 6q22.1
Protein Families Transmembrane, Druggable Genome
MW 104.6 kDa
Gene Summary Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain (summary by Pi et al., 2005 [PubMed 16199532]).[supplied by OMIM, Nov 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)