TRIM47 (NM_033452) Human Tagged ORF Clone

CAT#: RC218521

Reviews ()
Write a review

TRIM47 (Myc-DDK-tagged)-Human tripartite motif containing 47 (TRIM47)



  "NM_033452" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 594.00

USD 891.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "TRIM47"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRIM47
Synonyms GOA; RNF100
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218521 representing NM_033452
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGGCAGTGGACCCTTCAGCTGCCCCATCTGCCTAGAGCCACTCCGGGAGCCGGTGACGCTGCCCT
GCGGCCACAACTTCTGTCTCGCCTGCCTGGGCGCGCTCTGGCCGCATCGTGGCGCGAGTGGAGCCGGCGG
ACCCGGAGGCGCGGCCCGCTGCCCGCTGTGCCAGGAGCCCTTCCCCGACGGCCTTCAGCTCCGCAAGAAC
CACACGCTGTCCGAGCTGCTGCAGCTCCGCCAGGGCTCGGGCCCCGGGTCCGGCCCCGGCCCGGCCCCTG
CCCTGGCCCCGGAGCCCTCGGCACCCAGCGCGCTGCCCAGTGTCCCGGAGCCGTCGGCCCCCTGCGCTCC
CGAGCCGTGGCCCGCGGGCGAAGAGCCAGTGCGCTGCGACGCGTGCCCCGAGGGCGCGGCCCTGCCCGCC
GCGCTGTCCTGCCTCTCCTGCCTCGCCTCCTTTTGCCCCGCGCACCTGGGCCCGCACGAGCGCAGCCCCG
CCCTCCGCGGACACCGCCTGGTGCCGCCGCTGCGCCGGCTAGAGGAGAGCCTGTGCCCGCGCCACCTACG
GCCGCTCGAGCGCTACTGCCGCGCGGAGCGCGTGTGTCTGTGCGAGGCCTGCGCCGCACAGGAGCACCGC
GGCCACGAGCTGGTGCCGCTGGAGCAGGAGCGCGCGCTTCAGGAGGCTGAGCAGTCCAAAGTCCTGAGCG
CCGTGGAGGACCGCATGGACGAGCTGGGTGCTGGCATTGCACAGTCCAGGCGCACAGTGGCCCTCATCAA
GAGTGCAGCCGTAGCAGAGCGGGAGAGGGTGAGCCGGCTGTTTGCAGATGCTGCGGCCGCCCTGCAGGGC
TTCCAGACCCAGGTGCTGGGCTTCATCGAGGAGGGGGAAGCTGCCATGCTAGGCCGCTCCCAGGGTGACC
TGCGGCGACAGGAGGAACAGCGCAGCCGCCTGAGCCGAGCCCGCCAGAATCTCAGCCAGGTCCCTGAAGC
TGACTCAGTCAGCTTCCTGCAGGAGCTGCTGGCACTAAGGCTGGCCCTGGAGGATGGGTGTGGCCCTGGG
CCTGGACCCCCGAGGGAGCTCAGCTTCACCAAATCATCCCAAGCTGTCCGTGCAGTGAGAGACATGCTGG
CCGTGGCCTGCGTCAACCAGTGGGAGCAGCTGAGGGGGCCGGGTGGCAACGAGGATGGGCCACAGAAGCT
GGACTCGGAAGCTGATGCTGAGCCCCAAGACCTCGAGAGTACGAACCTCTTGGAGAGTGAAGCTCCCAGG
GACTATTTCCTCAAGTTTGCCTATATTGTGGATTTGGACAGCGACACAGCAGACAAGTTCCTGCAGCTGT
TTGGAACCAAAGGTGTCAAGAGGGTGCTGTGTCCTATCAACTACCCCTTGTCGCCCACCCGCTTCACCCA
TTGTGAGCAGGTGCTGGGCGAGGGTGCCCTGGACCGAGGCACCTACTACTGGGAGGTGGAGATTATCGAG
GGCTGGGTCAGCATGGGGGTCATGGCCGAAGACTTCTCCCCACAAGAGCCCTACGACCGCGGCCGGCTGG
GCCGCAACGCCCACTCCTGCTGCCTGCAGTGGAATGGACGCAGCTTCTCCGTCTGGTTTCATGGGCTGGA
GGCTCCCCTGCCCCACCCCTTCTCGCCCACGGTTGGGGTCTGCCTGGAATACGCTGACCGTGCCTTGGCC
TTCTATGCTGTACGGGACGGCAAGATGAGCCTCCTGCGGAGGCTGAAGGCCTCCCGGCCCCGCCGGGGTG
GCATCCCGGCCTCCCCCATTGACCCCTTCCAGAGCCGCCTGGACAGTCACTTTGCGGGGCTCTTCACCCA
CAGACTCAAGCCTGCCTTCTTCCTGGAGAGTGTGGACGCCCACTTGCAGATCGGGCCCCTCAAGAAGTCC
TGCATATCCGTGCTGAAGAGGAGG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC218521 representing NM_033452
Red=Cloning site Green=Tags(s)

MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEPFPDGLQLRKN
HTLSELLQLRQGSGPGSGPGPAPALAPEPSAPSALPSVPEPSAPCAPEPWPAGEEPVRCDACPEGAALPA
ALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLCPRHLRPLERYCRAERVCLCEACAAQEHR
GHELVPLEQERALQEAEQSKVLSAVEDRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFADAAAALQG
FQTQVLGFIEEGEAAMLGRSQGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEDGCGPG
PGPPRELSFTKSSQAVRAVRDMLAVACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLESEAPR
DYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRGTYYWEVEIIE
GWVSMGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPHPFSPTVGVCLEYADRALA
FYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKS
CISVLKRR

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033452
ORF Size 1914 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_033452.3
RefSeq Size 2268 bp
RefSeq ORF 1917 bp
Locus ID 91107
UniProt ID Q96LD4
Cytogenetics 17q25.1
Protein Families Druggable Genome
MW 69.4 kDa
Gene Summary E3 ubiquitin-protein ligase that mediates the ubiquitination and proteasomal degradation of CYLD.[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


TRIM47 rabbit polyclonal antibody
    • 25 ul

USD 800.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.