LRP1 (NM_002332) Human Tagged ORF Clone

CAT#: RC218369

Reviews ()
Write a review

LRP1 (Myc-DDK-tagged)-Human low density lipoprotein receptor-related protein 1 (LRP1)



  "NM_002332" in other vectors (3)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 6,176.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LRP1
Synonyms A2MR; APOER; APR; CD91; IGFBP-3R; IGFBP3R; IGFBP3R1; KPA; LRP; LRP1A; TGFBR5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218369 representing NM_002332.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGCTGACCCCGCCGTTGCTCCTGCTGCTGCCCCTGCTCTCAGCTCTGGTCGCGGCGGCTATCGACGCC
CCTAAGACTTGCAGCCCCAAGCAGTTTGCCTGCAGAGATCAAATAACCTGTATCTCAAAGGGCTGGCGG
TGCGACGGTGAGAGGGACTGCCCAGACGGATCTGACGAGGCCCCTGAGATTTGTCCACAGAGTAAGGCC
CAGCGATGCCAGCCAAACGAGCATAACTGCCTGGGTACTGAGCTGTGTGTTCCCATGTCCCGCCTCTGC
AATGGGGTCCAGGACTGCATGGACGGCTCAGATGAGGGGCCCCACTGCCGAGAGCTCCAAGGCAACTGC
TCTCGCCTGGGCTGCCAGCACCATTGTGTCCCCACACTCGATGGGCCCACCTGCTACTGCAACAGCAGC
TTTCAGCTTCAGGCAGATGGCAAGACCTGCAAAGATTTTGATGAGTGCTCAGTGTACGGCACCTGCAGC
CAGCTATGCACCAACACAGACGGCTCCTTCATATGTGGCTGTGTTGAAGGATACCTCCTGCAGCCGGAT
AACCGCTCCTGCAAGGCCAAGAACGAGCCAGTAGACCGGCCCCCTGTGCTGTTGATAGCCAACTCCCAG
AACATCTTGGCCACGTACCTGAGTGGGGCCCAGGTGTCTACCATCACACCTACGAGCACGCGGCAGACC
ACAGCCATGGACTTCAGCTATGCCAACGAGACCGTATGCTGGGTGCATGTTGGGGACAGTGCTGCTCAG
ACGCAGCTCAAGTGTGCCCGCATGCCTGGCCTAAAGGGCTTCGTGGATGAGCACACCATCAACATCTCC
CTCAGTCTGCACCACGTGGAACAGATGGCCATCGACTGGCTGACAGGCAACTTCTACTTTGTGGATGAC
ATCGATGATAGGATCTTTGTCTGCAACAGAAATGGGGACACATGTGTCACATTGCTAGACCTGGAACTC
TACAACCCCAAGGGCATTGCCCTGGACCCTGCCATGGGGAAGGTGTTTTTCACTGACTATGGGCAGATC
CCAAAGGTGGAACACTGTGACATGGATGGGCAGAACCGCACCAAGCTCGTCGACAGCAAGATTGTGTTT
CCTCATGGCATCACGCTGGACCTGGTCAGCCGCCTTGTCTACTGGGCAGATGCCTATCTGGACTATATT
GAAGTGGTGGACTATGAGGGCAAGGGCCGCCAGACCATCATCCAGGGCATCCTGATTGAGCACCTGTAC
GGCCTGACTGTGTTTGAGAATTATCTCTATGCCACCAACTCGGACAATGCCAATGCCCAGCAGAAGACG
AGTGTGATCCGTGTGAACCGCTTTAACAGCACCGAGTACCAGGTTGTCACCCGGGTGGACAAGGGTGGT
GCCCTCCACATCTACCACCAGAGGCGTCAGCCCCGAGTGAGGAGCCATGCCTGTGAAAACGACCAGTAT
GGGAAGCCGGGTGGCTGCTCTGACATCTGCCTGCTGGCCAACAGCCACAAGGCGCGGACCTGCCGCTGC
CGTTCCGGCTTCAGCCTGGGCAGTGACGGGAAGTCATGCAAGAAGCCGGAGCATGAGCTGTTCCTCGTG
TATGGCAAGGGCCGGCCAGGCATCATCCGGGGCATGGATATGGGGGCCAAGGTCCCGGATGAGCACATG
ATCCCCATTGAAAACCTCATGAACCCCCGAGCCCTGGACTTCCACGCTGAGACCGGCTTCATCTACTTT
GCCGACACCACCAGCTACCTCATTGGCCGCCAGAAGATTGATGGCACTGAGCGGGAGACCATCCTGAAG
GACGGCATCCACATTGTGGAGGGTGTGGCCGTGGACTGGATGGGAGACAATCTGTACTGGACGGACGAT
GGGCCCAAAAAGACAATCAGCGTGGCCAGGCTGGAGAAAGCTGCTCAGACCCGCAAGACTTTAATCGAG
GGCAAAATGACACACCCCAGGGCTATTGTGGTGGATCCACTCAATGGGTGGATGTACTGGACAGACTGG
GAGGAGGACCCCAAGGACAGTCGGCGTGGGCGGCTGGAGAGGGCGTGGATGGATGGCTCACACCGAGAC
ATCTTTGTCACCTCCAAGACAGTGCTTTGGCCCAATGGGCTAAGCCTGGACATCCCGGCTGGGCGCCTC
TACTGGGTGGATGCCTTCTACGACCGCATCGAGACGATACTGCTCAATGGCACAGACCGGAAGATTGTG
TATGAAGGTCCTGAGCTGAACCACGCCTTTGGCCTGTGTCACCATGGCAACTACCTCTTCTGGACTGAG
TATCGGAGTGGCAGTGTCTACCGCTTGGAACGGGGTGTAGGAGGCGCACCCCCCACTGTGACCCTTCTG
CGCAGTGAGCGGCCCCCCATCTTTGAGATCCGAATGTATGATGCCCAGCAGCAGCAAGTTGGCACCAAC
AAATGCCGGGTGAACAATGGCGGCTGCAGCAGCCTGTGCTTGGCCACCCCTGGGAGCCGCCAGTGCGCC
TGTGCTGAGGACCAGGTGTTGGACGCAGACGGCGTCACTTGCTTGGCGAACCCATCCTACGTGCCTCCA
CCCCAGTGCCAGCCAGGCGAGTTTGCCTGTGCCAACAGCCGCTGCATCCAGGAGCGCTGGAAGTGTGAC
GGAGACAACGATTGCCTGGACAACAGTGATGAGGCCCCAGCCCTCTGCCATCAGCACACCTGCCCCTCG
GACCGATTCAAGTGCGAGAACAACCGGTGCATCCCCAACCGCTGGCTCTGCGACGGGGACAATGACTGT
GGGAACAGTGAAGATGAGTCCAATGCCACTTGTTCAGCCCGCACCTGCCCCCCCAACCAGTTCTCCTGT
GCCAGTGGCCGCTGCATCCCCATCTCCTGGACGTGTGATCTGGATGACGACTGTGGGGACCGCTCTGAT
GAGTCTGCTTCGTGTGCCTATCCCACCTGCTTCCCCCTGACTCAGTTTACCTGCAACAATGGCAGATGT
ATCAACATCAACTGGAGATGCGACAATGACAATGACTGTGGGGACAACAGTGACGAAGCCGGCTGCAGC
CACTCCTGTTCTAGCACCCAGTTCAAGTGCAACAGCGGGCGTTGCATCCCCGAGCACTGGACCTGCGAT
GGGGACAATGACTGCGGAGACTACAGTGATGAGACACACGCCAACTGCACCAACCAGGCCACGAGGCCC
CCTGGTGGCTGCCACACTGATGAGTTCCAGTGCCGGCTGGATGGACTATGCATCCCCCTGCGGTGGCGC
TGCGATGGGGACACTGACTGCATGGACTCCAGCGATGAGAAGAGCTGTGAGGGAGTGACCCACGTCTGC
GATCCCAGTGTCAAGTTTGGCTGCAAGGACTCAGCTCGGTGCATCAGCAAAGCGTGGGTGTGTGATGGC
GACAATGACTGTGAGGATAACTCGGACGAGGAGAACTGCGAGTCCCTGGCCTGCAGGCCACCCTCGCAC
CCTTGTGCCAACAACACCTCAGTCTGCCTGCCCCCTGACAAGCTGTGTGATGGCAACGACGACTGTGGC
GACGGCTCAGATGAGGGCGAGCTCTGTGACCAGTGCTCTCTGAATAACGGTGGCTGCAGCCACAACTGC
TCAGTGGCACCTGGCGAAGGCATTGTGTGTTCCTGCCCTCTGGGCATGGAGCTGGGGCCCGACAACCAC
ACCTGCCAGATCCAGAGCTACTGTGCCAAGCATCTCAAATGCAGCCAAAAGTGCGACCAGAACAAGTTC
AGCGTGAAGTGCTCCTGCTACGAGGGCTGGGTCCTGGAACCTGACGGCGAGAGCTGCCGCAGCCTGGAC
CCCTTCAAGCCGTTCATCATTTTCTCCAACCGCCATGAAATCCGGCGCATCGATCTTCACAAAGGAGAC
TACAGCGTCCTGGTGCCCGGCCTGCGCAACACCATCGCCCTGGACTTCCACCTCAGCCAGAGCGCCCTC
TACTGGACCGACGTGGTGGAGGACAAGATCTACCGCGGGAAGCTGCTGGACAACGGAGCCCTGACTAGT
TTCGAGGTGGTGATTCAGTATGGCCTGGCCACACCCGAGGGCCTGGCTGTAGACTGGATTGCAGGCAAC
ATCTACTGGGTGGAGAGTAACCTGGATCAGATCGAGGTGGCCAAGCTGGATGGGACCCTCCGGACCACC
CTGCTGGCCGGTGACATTGAGCACCCAAGGGCAATCGCACTGGATCCCCGGGATGGGATCCTGTTTTGG
ACAGACTGGGATGCCAGCCTGCCCCGCATTGAGGCAGCCTCCATGAGTGGGGCTGGGCGCCGCACCGTG
CACCGGGAGACCGGCTCTGGGGGCTGGCCCAACGGGCTCACCGTGGACTACCTGGAGAAGCGCATCCTT
TGGATTGACGCCAGGTCAGATGCCATTTACTCAGCCCGTTACGACGGCTCTGGCCACATGGAGGTGCTT
CGGGGACACGAGTTCCTGTCGCACCCGTTTGCAGTGACGCTGTACGGGGGGGAGGTCTACTGGACTGAC
TGGCGAACAAACACACTGGCTAAGGCCAACAAGTGGACCGGCCACAATGTCACCGTGGTACAGAGGACC
AACACCCAGCCCTTTGACCTGCAGGTGTACCACCCCTCCCGCCAGCCCATGGCTCCCAATCCCTGTGAG
GCCAATGGGGGCCAGGGCCCCTGCTCCCACCTGTGTCTCATCAACTACAACCGGACCGTGTCCTGCGCC
TGCCCCCACCTCATGAAGCTCCACAAGGACAACACCACCTGCTATGAGTTTAAGAAGTTCCTGCTGTAC
GCACGTCAGATGGAGATCCGAGGTGTGGACCTGGATGCTCCCTACTACAACTACATCATCTCCTTCACG
GTGCCCGACATCGACAACGTCACAGTGCTAGACTACGATGCCCGCGAGCAGCGTGTGTACTGGTCTGAC
GTGCGGACACAGGCCATCAAGCGGGCCTTCATCAACGGCACAGGCGTGGAGACAGTCGTCTCTGCAGAC
TTGCCAAATGCCCACGGGCTGGCTGTGGACTGGGTCTCCCGAAACCTGTTCTGGACAAGCTATGACACC
AATAAGAAGCAGATCAATGTGGCCCGGCTGGATGGCTCCTTCAAGAACGCAGTGGTGCAGGGCCTGGAG
CAGCCCCATGGCCTTGTCGTCCACCCTCTGCGTGGGAAGCTCTACTGGACCGATGGTGACAACATCAGC
ATGGCCAACATGGATGGCAGCAATCGCACCCTGCTCTTCAGTGGCCAGAAGGGCCCCGTGGGCCTGGCT
ATTGACTTCCCTGAAAGCAAACTCTACTGGATCAGCTCCGGGAACCATACCATCAACCGCTGCAACCTG
GATGGGAGTGGGCTGGAGGTCATCGATGCCATGCGGAGCCAGCTGGGCAAGGCCACCGCCCTGGCCATC
ATGGGGGACAAGCTGTGGTGGGCTGATCAGGTGTCGGAAAAGATGGGCACATGCAGCAAGGCTGACGGC
TCGGGCTCCGTGGTCCTTCGGAACAGCACCACCCTGGTGATGCACATGAAGGTCTATGACGAGAGCATC
CAGCTGGACCATAAGGGCACCAACCCCTGCAGTGTCAACAACGGTGACTGCTCCCAGCTCTGCCTGCCC
ACGTCAGAGACGACCCGCTCCTGCATGTGCACAGCCGGCTATAGCCTCCGGAGTGGCCAGCAGGCCTGC
GAGGGCGTAGGTTCCTTTCTCCTGTACTCTGTGCATGAGGGAATCAGGGGAATTCCCCTGGATCCCAAT
GACAAGTCAGATGCCCTGGTCCCAGTGTCCGGGACCTCGCTGGCTGTCGGCATCGACTTCCACGCTGAA
AATGACACCATCTACTGGGTGGACATGGGCCTGAGCACGATCAGCCGGGCCAAGCGGGACCAGACGTGG
CGTGAAGACGTGGTGACCAATGGCATTGGCCGTGTGGAGGGCATTGCAGTGGACTGGATCGCAGGCAAC
ATCTACTGGACAGACCAGGGCTTTGATGTCATCGAGGTCGCCCGGCTCAATGGCTCCTTCCGCTACGTG
GTGATCTCCCAGGGTCTAGACAAGCCCCGGGCCATCACCGTCCACCCGGAGAAAGGGTACTTGTTCTGG
ACTGAGTGGGGTCAGTATCCGCGTATTGAGCGGTCTCGGCTAGATGGCACGGAGCGTGTGGTGCTGGTC
AACGTCAGCATCAGCTGGCCCAACGGCATCTCAGTGGACTACCAGGATGGGAAGCTGTACTGGTGCGAT
GCACGGACAGACAAGATTGAACGGATCGACCTGGAGACAGGTGAGAACCGCGAGGTGGTTCTGTCCAGC
AACAACATGGACATGTTTTCAGTGTCTGTGTTTGAGGATTTCATCTACTGGAGTGACAGGACTCATGCC
AACGGCTCTATCAAGCGCGGGAGCAAAGACAATGCCACAGACTCCGTGCCCCTGCGAACCGGCATCGGC
GTCCAGCTTAAAGACATCAAAGTCTTCAACCGGGACCGGCAGAAAGGCACCAACGTGTGCGCGGTGGCC
AATGGCGGGTGCCAGCAGCTGTGCCTGTACCGGGGCCGTGGGCAGCGGGCCTGCGCCTGTGCCCACGGG
ATGCTGGCTGAAGACGGAGCATCGTGCCGCGAGTATGCCGGCTACCTGCTCTACTCAGAGCGCACCATT
CTCAAGAGTATCCACCTGTCGGATGAGCGCAACCTCAATGCGCCCGTGCAGCCCTTCGAGGACCCTGAG
CACATGAAGAACGTCATCGCCCTGGCCTTTGACTACCGGGCAGGCACCTCTCCGGGCACCCCCAATCGC
ATCTTCTTCAGCGACATCCACTTTGGGAACATCCAACAGATCAACGACGATGGCTCCAGGAGGATCACC
ATTGTGGAAAACGTGGGCTCCGTGGAAGGCCTGGCCTATCACCGTGGCTGGGACACTCTCTATTGGACA
AGCTACACGACATCCACCATCACGCGCCACACAGTGGACCAGACCCGCCCAGGGGCCTTCGAGCGTGAG
ACCGTCATCACTATGTCTGGAGATGACCACCCACGGGCCTTCGTTTTGGACGAGTGCCAGAACCTCATG
TTCTGGACCAACTGGAATGAGCAGCATCCCAGCATCATGCGGGCGGCGCTCTCGGGAGCCAATGTCCTG
ACCCTTATCGAGAAGGACATCCGTACCCCCAATGGCCTGGCCATCGACCACCGTGCCGAGAAGCTCTAC
TTCTCTGACGCCACCCTGGACAAGATCGAGCGGTGCGAGTATGACGGCTCCCACCGCTATGTGATCCTA
AAGTCAGAGCCTGTCCACCCCTTCGGGCTGGCCGTGTATGGGGAGCACATTTTCTGGACTGACTGGGTG
CGGCGGGCAGTGCAGCGGGCCAACAAGCACGTGGGCAGCAACATGAAGCTGCTGCGCGTGGACATCCCC
CAGCAGCCCATGGGCATCATCGCCGTGGCCAACGACACCAACAGCTGTGAACTCTCTCCATGCCGAATC
AACAACGGTGGCTGCCAGGACCTGTGTCTGCTCACTCACCAGGGCCATGTCAACTGCTCATGCCGAGGG
GGCCGAATCCTCCAGGATGACCTCACCTGCCGAGCGGTGAATTCCTCTTGCCGAGCACAAGATGAGTTT
GAGTGTGCCAATGGCGAGTGCATCAACTTCAGCCTGACCTGCGACGGCGTCCCCCACTGCAAGGACAAG
TCCGATGAGAAGCCATCCTACTGCAACTCCCGCCGCTGCAAGAAGACTTTCCGGCAGTGCAGCAATGGG
CGCTGTGTGTCCAACATGCTGTGGTGCAACGGGGCCGACGACTGTGGGGATGGCTCTGACGAGATCCCT
TGCAACAAGACAGCCTGTGGTGTGGGCGAGTTCCGCTGCCGGGACGGGACCTGCATCGGGAACTCCAGC
CGCTGCAACCAGTTTGTGGATTGTGAGGACGCCTCAGATGAGATGAACTGCAGTGCCACCGACTGCAGC
AGCTACTTCCGCCTGGGCGTGAAGGGCGTGCTCTTCCAGCCCTGCGAGCGGACCTCACTCTGCTACGCA
CCCAGCTGGGTGTGTGATGGCGCCAATGACTGTGGGGACTACAGTGATGAGCGCGACTGCCCAGGTGTG
AAACGCCCCAGATGCCCTCTGAATTACTTCGCCTGCCCTAGTGGGCGCTGCATCCCCATGAGCTGGACG
TGTGACAAAGAGGATGACTGTGAACATGGCGAGGACGAGACCCACTGCAACAAGTTCTGCTCAGAGGCC
CAGTTTGAGTGCCAGAACCATCGCTGCATCTCCAAGCAGTGGCTGTGTGACGGCAGCGATGACTGTGGG
GATGGCTCAGACGAGGCTGCTCACTGTGAAGGCAAGACGTGCGGCCCCTCCTCCTTCTCCTGCCCTGGC
ACCCACGTGTGCGTCCCCGAGCGCTGGCTCTGTGACGGTGACAAAGACTGTGCTGATGGTGCAGACGAG
AGCATCGCAGCTGGTTGCTTGTACAACAGCACTTGTGACGACCGTGAGTTCATGTGCCAGAACCGCCAG
TGCATCCCCAAGCACTTCGTGTGTGACCACGACCGTGACTGTGCAGATGGCTCTGATGAGTCCCCCGAG
TGTGAGTACCCGACCTGCGGCCCCAGTGAGTTCCGCTGTGCCAATGGGCGCTGTCTGAGCTCCCGCCAG
TGGGAGTGTGATGGCGAGAATGACTGCCACGACCAGAGTGACGAGGCTCCCAAGAACCCACACTGCACC
AGCCAAGAGCACAAGTGCAATGCCTCGTCACAGTTCCTGTGCAGCAGTGGGCGCTGTGTGGCTGAGGCA
CTGCTCTGCAACGGCCAGGATGACTGTGGCGACAGCTCGGACGAGCGTGGCTGCCACATCAATGAGTGT
CTCAGCCGCAAGCTCAGTGGCTGCAGCCAGGACTGTGAGGACCTCAAGATCGGCTTCAAGTGCCGCTGT
CGCCCTGGCTTCCGGCTGAAGGACGACGGCCGGACGTGTGCTGATGTGGACGAGTGCAGCACCACCTTC
CCCTGCAGCCAGCGCTGCATCAACACTCATGGCAGCTATAAGTGTCTGTGTGTGGAGGGCTATGCACCC
CGCGGCGGCGACCCCCACAGCTGCAAGGCTGTGACTGACGAGGAACCGTTTCTGATCTTCGCCAACCGG
TACTACCTGCGCAAGCTCAACCTGGACGGGTCCAACTACACGTTACTTAAGCAGGGCCTGAACAACGCC
GTTGCCTTGGATTTTGACTACCGAGAGCAGATGATCTACTGGACAGATGTGACCACCCAGGGCAGCATG
ATCCGAAGGATGCACCTTAACGGGAGCAATGTGCAGGTCCTACACCGTACAGGCCTCAGCAACCCCGAT
GGGCTGGCTGTGGACTGGGTGGGTGGCAACCTGTACTGGTGCGACAAAGGCCGGGACACCATCGAGGTG
TCCAAGCTCAATGGGGCCTATCGGACGGTGCTGGTCAGCTCTGGCCTCCGTGAGCCCAGGGCTCTGGTG
GTGGATGTGCAGAATGGGTACCTGTACTGGACAGACTGGGGTGACCATTCACTGATCGGCCGCATCGGC
ATGGATGGGTCCAGCCGCAGCGTCATCGTGGACACCAAGATCACATGGCCCAATGGCCTGACGCTGGAC
TATGTCACTGAGCGCATCTACTGGGCCGACGCCCGCGAGGACTACATTGAATTTGCCAGCCTGGATGGC
TCCAATCGCCACGTTGTGCTGAGCCAGGACATCCCGCACATCTTTGCACTGACCCTGTTTGAGGACTAC
GTCTACTGGACCGACTGGGAAACAAAGTCCATTAACCGAGCCCACAAGACCACGGGCACCAACAAAACG
CTCCTCATCAGCACGCTGCACCGGCCCATGGACCTGCATGTCTTCCATGCCCTGCGCCAGCCAGACGTG
CCCAATCACCCCTGCAAGGTCAACAATGGTGGCTGCAGCAACCTGTGCCTGCTGTCCCCCGGGGGAGGG
CACAAATGTGCCTGCCCCACCAACTTCTACCTGGGCAGCGATGGGCGCACCTGTGTGTCCAACTGCACG
GCTAGCCAGTTTGTATGCAAGAACGACAAGTGCATCCCCTTCTGGTGGAAGTGTGACACCGAGGACGAC
TGCGGGGACCACTCAGACGAGCCCCCGGACTGCCCTGAGTTCAAGTGCCGGCCCGGACAGTTCCAGTGC
TCCACAGGTATCTGCACAAACCCTGCCTTCATCTGCGATGGCGACAATGACTGCCAGGACAACAGTGAC
GAGGCCAACTGTGACATCCACGTCTGCTTGCCCAGTCAGTTCAAATGCACCAACACCAACCGCTGTATT
CCCGGCATCTTCCGCTGCAATGGGCAGGACAACTGCGGAGATGGGGAGGATGAGAGGGACTGCCCCGAG
GTGACCTGCGCCCCCAACCAGTTCCAGTGCTCCATTACCAAACGGTGCATCCCCCGGGTCTGGGTCTGC
GACCGGGACAATGACTGTGTGGATGGCAGTGATGAGCCCGCCAACTGCACCCAGATGACCTGTGGTGTG
GACGAGTTCCGCTGCAAGGATTCGGGCCGCTGCATCCCAGCGCGTTGGAAGTGTGACGGAGAGGATGAC
TGTGGGGATGGCTCGGATGAGCCCAAGGAAGAGTGTGATGAACGCACCTGTGAGCCATACCAGTTCCGC
TGCAAGAACAACCGCTGCGTGCCCGGCCGCTGGCAGTGCGACTACGACAACGATTGCGGTGACAACTCC
GATGAAGAGAGCTGCACCCCTCGGCCCTGCTCCGAGAGTGAGTTCTCCTGTGCCAACGGCCGCTGCATC
GCGGGGCGCTGGAAATGCGATGGAGACCACGACTGCGCGGACGGCTCGGACGAGAAAGACTGCACCCCC
CGCTGTGACATGGACCAGTTCCAGTGCAAGAGCGGCCACTGCATCCCCCTGCGCTGGCGCTGTGACGCA
GACGCCGACTGCATGGACGGCAGCGACGAGGAGGCCTGCGGCACTGGCGTGCGGACCTGCCCCCTGGAC
GAGTTCCAGTGCAACAACACCTTGTGCAAGCCGCTGGCCTGGAAGTGCGATGGCGAGGATGACTGTGGG
GACAACTCAGATGAGAACCCCGAGGAGTGTGCCCGGTTCGTGTGCCCTCCCAACCGGCCCTTCCGTTGC
AAGAATGACCGCGTCTGTCTGTGGATCGGGCGCCAATGCGATGGCACGGACAACTGTGGGGATGGGACT
GATGAAGAGGACTGTGAGCCCCCCACAGCCCACACCACCCACTGCAAAGACAAGAAGGAGTTTCTGTGC
CGGAACCAGCGCTGCCTCTCCTCCTCCCTGCGCTGCAACATGTTCGATGACTGCGGGGACGGCTCTGAC
GAGGAGGACTGCAGCATCGACCCCAAGCTGACCAGCTGCGCCACCAATGCCAGCATCTGTGGGGACGAG
GCACGCTGCGTGCGCACCGAGAAAGCGGCCTACTGTGCCTGCCGCTCGGGCTTCCACACCGTGCCCGGC
CAGCCCGGATGCCAAGACATCAACGAGTGCCTGCGCTTCGGCACCTGCTCCCAGCTCTGCAACAACACC
AAGGGCGGCCACCTCTGCAGCTGCGCTCGGAACTTCATGAAGACGCACAACACCTGCAAGGCCGAAGGC
TCTGAGTACCAGGTCCTGTACATCGCTGATGACAATGAGATCCGCAGCCTGTTCCCCGGCCACCCCCAT
TCGGCTTACGAGCAGGCATTCCAGGGTGACGAGAGTGTCCGCATTGATGCTATGGATGTCCATGTCAAG
GCTGGCCGTGTCTATTGGACCAACTGGCACACGGGCACCATCTCCTACCGCAGCCTGCCACCTGCTGCG
CCTCCTACCACTTCCAACCGCCACCGGCGACAGATTGACCGGGGTGTCACCCACCTCAACATTTCAGGG
CTGAAGATGCCCAGAGGCATCGCCATCGACTGGGTGGCCGGAAACGTGTACTGGACCGACTCGGGCCGA
GATGTGATTGAGGTGGCGCAGATGAAGGGCGAGAACCGCAAGACGCTCATCTCGGGCATGATTGACGAG
CCCCACGCCATTGTGGTGGACCCACTGAGGGGGACCATGTACTGGTCAGACTGGGGCAACCACCCCAAG
ATTGAGACGGCAGCGATGGATGGGACGCTTCGGGAGACACTGGTGCAGGACAACATTCAGTGGCCCACA
GGCCTGGCCGTGGATTATCACAATGAGCGGCTGTACTGGGCAGACGCCAAGCTTTCAGTCATCGGCAGC
ATCCGGCTCAATGGCACGGACCCCATTGTGGCTGCTGACAGCAAACGAGGCCTAAGTCACCCCTTCAGC
ATCGACGTCTTTGAGGATTACATCTATGGTGTCACCTACATCAATAATCGTGTCTTCAAGATCCATAAG
TTTGGCCACAGCCCCTTGGTCAACCTGACAGGGGGCCTGAGCCACGCCTCTGACGTGGTCCTTTACCAT
CAGCACAAGCAGCCCGAAGTGACCAACCCATGTGACCGCAAGAAATGCGAGTGGCTCTGCCTGCTGAGC
CCCAGTGGGCCTGTCTGCACCTGTCCCAATGGGAAGCGGCTGGACAACGGCACATGCGTGCCTGTGCCC
TCTCCAACGCCCCCCCCAGATGCTCCCCGGCCTGGAACCTGTAACCTGCAGTGCTTCAACGGTGGCAGC
TGTTTCCTCAATGCACGGAGGCAGCCCAAGTGCCGCTGCCAACCCCGCTACACGGGTGACAAGTGTGAA
CTGGACCAGTGCTGGGAGCACTGTCGCAATGGGGGCACCTGTGCTGCCTCCCCCTCTGGCATGCCCACG
TGCCGGTGCCCCACGGGCTTCACGGGCCCCAAATGCACCCAGCAGGTGTGTGCGGGCTACTGTGCCAAC
AACAGCACCTGCACTGTCAACCAGGGCAACCAGCCCCAGTGCCGATGCCTACCCGGCTTCCTGGGCGAC
CGCTGCCAGTACCGGCAGTGCTCTGGCTACTGTGAGAACTTTGGCACATGCCAGATGGCTGCTGATGGC
TCCCGACAATGCCGCTGCACTGCCTACTTTGAGGGATCGAGGTGTGAGGTGAACAAGTGCAGCCGCTGT
CTCGAAGGGGCCTGTGTGGTCAACAAGCAGAGTGGGGATGTCACCTGCAACTGCACGGATGGCCGGGTG
GCCCCCAGCTGTCTGACCTGCGTCGGCCACTGCAGCAATGGCGGCTCCTGTACCATGAACAGCAAAATG
ATGCCTGAGTGCCAGTGCCCACCCCACATGACAGGGCCCCGGTGTGAGGAGCACGTCTTCAGCCAGCAG
CAGCCAGGACATATAGCCTCCATCCTAATCCCTCTGCTGTTGCTGCTGCTGCTGGTTCTGGTGGCCGGA
GTGGTATTCTGGTATAAGCGGCGAGTCCAAGGGGCTAAGGGCTTCCAGCACCAACGGATGACCAACGGG
GCCATGAACGTGGAGATTGGAAACCCCACCTACAAGATGTACGAAGGCGGAGAGCCTGATGATGTGGGA
GGCCTACTGGACGCTGACTTTGCCCTGGACCCTGACAAGCCCACCAACTTCACCAACCCCGTGTATGCC
ACACTCTACATGGGGGGCCATGGCAGTCGCCACTCCCTGGCCAGCACGGACGAGAAGCGAGAACTCCTG
GGCCGGGGCCCTGAGGACGAGATAGGGGACCCCTTGGCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC218369
Blue=ORF Red=Cloning site Green=Tag(s)

MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKA
QRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSS
FQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQ
NILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINIS
LSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQI
PKVEHCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLY
GLTVFENYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQY
GKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHM
IPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHIVEGVAVDWMGDNLYWTDD
GPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAWMDGSHRD
IFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTE
YRSGSVYRLERGVGGAPPTVTLLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCA
CAEDQVLDADGVTCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPS
DRFKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSD
ESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCD
GDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVC
DPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDKLCDGNDDCG
DGSDEGELCDQCSLNNGGCSHNCSVAPGEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKF
SVKCSCYEGWVLEPDGESCRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSAL
YWTDVVEDKIYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLTVDYLEKRIL
WIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRT
NTQPFDLQVYHPSRQPMAPNPCEANGGQGPCSHLCLINYNRTVSCACPHLMKLHKDNTTCYEFKKFLLY
ARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSAD
LPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNIS
MANMDGSNRTLLFSGQKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAI
MGDKLWWADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQLCLP
TSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAE
NDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYV
VISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGTERVVLVNVSISWPNGISVDYQDGKLYWCD
ARTDKIERIDLETGENREVVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIG
VQLKDIKVFNRDRQKGTNVCAVANGGCQQLCLYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTI
LKSIHLSDERNLNAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRIT
IVENVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQNLM
FWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVIL
KSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVGSNMKLLRVDIPQQPMGIIAVANDTNSCELSPCRI
NNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAVNSSCRAQDEFECANGECINFSLTCDGVPHCKDK
SDEKPSYCNSRRCKKTFRQCSNGRCVSNMLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSS
RCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGV
KRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCG
DGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDDREFMCQNRQ
CIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDGENDCHDQSDEAPKNPHCT
SQEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGCHINECLSRKLSGCSQDCEDLKIGFKCRC
RPGFRLKDDGRTCADVDECSTTFPCSQRCINTHGSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANR
YYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPD
GLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIG
MDGSSRSVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFEDY
VYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCLLSPGGG
HKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQC
STGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPE
VTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDD
CGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCI
AGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLD
EFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGT
DEEDCEPPTAHTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDPKLTSCATNASICGDE
ARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEG
SEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAA
PPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDE
PHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGS
IRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYH
QHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTCNLQCFNGGS
CFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGYCAN
NSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRC
LEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVFSQQ
QPGHIASILIPLLLLLLLVLVAGVVFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVG
GLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002332
ORF Size 13632 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002332.3
RefSeq Size 14896 bp
RefSeq ORF 13635 bp
Locus ID 4035
UniProt ID Q07954
Cytogenetics 12q13.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways Alzheimer's disease
MW 504.6 kDa
Gene Summary This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the alpha 2-macroglobulin-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer's disease patients. [provided by RefSeq, Oct 2015]

Other Versions

Other products for "LRP1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


LRP1 rabbit polyclonal antibody
    • 100 ul

USD 380.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.