ACAT1(ACACA) (NM_198834) Human Tagged ORF Clone

CAT#: RC218293

ACACA (Myc-DDK-tagged)-Human acetyl-CoA carboxylase alpha (ACACA), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ACAT1(ACACA) (NM_198834) Human Tagged ORF Clone
Symbol ACACA
Synonyms ACAC; ACACAD; ACC; ACC1; ACCA
Vector pCMV6-Entry
Sequence Data
>RC218293 representing NM_198834
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGTGGTCTACTCTGATGTCAATCTTGAGGGCTAGGTCTTTCTGGAAGTGGATATCTACTCAGACAG
TAAGAATTATAAGAGCTGTAAGAGCTCATTTTGGAGGAATAATGGATGAACCATCTCCCTTGGCCCAACC
TCTGGAGCTGAACCAGCACTCTCGATTCATAATAGGTTCTGTGTCTGAAGATAACTCAGAGGATGAGATC
AGCAACCTGGTGAAGTTGGACCTACTGGAGGAGAAGGAGGGCTCCTTGTCACCTGCTTCTGTTGGCTCAG
ATACACTCTCTGATTTGGGGATCTCTAGCCTACAGGATGGCTTGGCCTTGCACATAAGGTCCAGCATGTC
TGGCTTGCACCTAGTAAAGCAGGGCCGAGACAGAAAGAAAATAGATTCTCAACGAGATTTCACTGTGGCT
TCTCCAGCAGAATTTGTTACTCGCTTTGGGGGAAATAAAGTGATTGAGAAGGTTCTTATTGCTAACAATG
GCATTGCAGCAGTGAAATGCATGCGGTCTATCCGTAGGTGGTCTTATGAAATGTTTCGAAATGAACGTGC
AATTAGATTCGTTGTCATGGTCACACCTGAAGACCTTAAAGCCAATGCAGAATACATTAAGATGGCAGAT
CACTATGTGCCAGTGCCTGGAGGACCAAACAACAACAACTATGCAAATGTGGAATTAATTCTTGATATTG
CTAAAAGGATCCCAGTACAAGCAGTGTGGGCTGGCTGGGGTCATGCTTCTGAGAATCCCAAACTACCGGA
ACTTCTCTTGAAAAATGGCATTGCCTTCATGGGTCCTCCAAGCCAGGCCATGTGGGCTTTAGGGGATAAG
ATTGCATCTTCCATAGTGGCTCAAACTGCAGGTATCCCAACTCTTCCCTGGAGCGGCAGTGGTCTTCGTG
TGGACTGGCAGGAAAATGATTTTTCAAAACGTATCTTAAATGTTCCCCAGGAGCTATATGAAAAAGGTTA
TGTGAAAGATGTGGATGATGGGCTACAGGCAGCTGAGGAAGTTGGATATCCAGTAATGATCAAGGCCTCA
GAGGGAGGAGGAGGGAAGGGAATTAGAAAAGTCAACAATGCAGATGACTTCCCTAATCTCTTCAGACAGG
TTCAAGCTGAAGTTCCTGGATCTCCCATATTTGTGATGAGACTAGCCAAACAATCTCGTCATCTGGAGGT
GCAGATCTTAGCGGACCAATATGGCAATGCTATCTCTTTGTTTGGTCGTGATTGCTCTGTACAACGCAGG
CATCAGAAGATTATTGAAGAAGCACCTGCTACTATTGCTACTCCAGCAGTATTTGAACACATGGAACAGT
GTGCGGTGAAACTTGCCAAAATGGTGGGTTATGTGAGTGCTGGGACTGTGGAATACCTGTACAGCCAGGA
TGGCAGCTTCTACTTTCTGGAATTGAATCCTCGGCTGCAGGTAGAGCACCCTTGTACAGAGATGGTGGCT
GATGTCAATCTCCCTGCAGCACAGCTCCAGATTGCCATGGGGATTCCTCTATATAGAATCAAGGATATCC
GTATGATGTATGGGGTATCTCCCTGGGGTGATTCTCCCATTGATTTTGAAGATTCTGCACACGTTCCTTG
TCCAAGGGGCCATGTTATTGCTGCTCGGATCACTAGTGAAAATCCAGATGAGGGTTTTAAGCCCAGCTCA
GGAACAGTTCAGGAGCTAAATTTCCGCAGCAATAAGAATGTTTGGGGATATTTCAGTGTTGCTGCTGCAG
GGGGACTTCATGAATTTGCTGATTCTCAGTTTGGTCACTGCTTTTCTTGGGGAGAAAACAGAGAAGAGGC
AATTTCAAACATGGTGGTGGCTTTGAAGGAGCTGTCTATTCGGGGTGACTTTCGAACTACAGTTGAATAC
CTGATCAAATTGTTAGAGACTGAAAGCTTTCAGATGAACAGAATTGATACTGGCTGGCTGGACAGACTGA
TAGCAGAAAAAGTACAGGCTGAGCGACCTGACACCATGTTGGGGGTTGTGTGTGGTGCCCTCCACGTGGC
AGATGTGAGCCTGCGGAATAGCGTCTCTAACTTCCTTCACTCCTTAGAAAGGGGTCAAGTCCTTCCTGCT
CATACACTTCTGAATACAGTAGATGTTGAACTTATCTATGAGGGAGTCAAGTATGTACTTAAGGTGACTC
GACAGTCCCCCAACTCCTATGTGGTGATCATGAATGGCTCATGTGTAGAAGTAGATGTACATCGGCTGAG
TGACGGTGGACTGCTCTTGTCCTATGATGGCAGCAGTTATACTACGTATATGAAAGAGGAAGTGGATAGA
TATCGCATCACAATTGGCAATAAAACCTGTGTGTTTGAGAAGGAAAATGACCCATCGGTGATGCGCTCAC
CTTCTGCTGGGAAGTTAATCCAGTACATTGTAGAAGATGGAGGTCATGTGTTTGCCGGCCAGTGCTATGC
TGAGATTGAGGTAATGAAGATGGTAATGACCTTAACAGCTGTGGAGTCTGGCTGTATCCATTACGTCAAG
CGACCTGGAGCAGCTCTTGACCCTGGCTGTGTACTAGCCAAAATGCAACTGGACAACCCCAGCAAGGTTC
AGCAGGCTGAACTTCACACAGGTAGTCTGCCACGGATCCAGAGCACGGCACTCAGAGGCGAGAAACTCCA
TCGAGTGTTCCATTATGTCCTGGATAATCTGGTCAATGTAATGAATGGATACTGCCTTCCAGATCCTTTC
TTTAGCAGCAAGGTAAAAGACTGGGTAGAGCGATTGATGAAAACCCTCAGAGATCCCTCCCTGCCTCTCC
TAGAATTGCAAGATATTATGACCAGTGTGTCTGGCCGCATTCCCCCCAATGTGGAGAAGTCTATCAAGAA
GGAAATGGCTCAGTATGCTAGCAACATCACATCAGTCCTCTGTCAGTTTCCCAGCCAGCAGATTGCAAAC
ATCCTAGATAGCCATGCAGCTACATTGAACCGGAAATCTGAACGGGAAGTCTTCTTTATGAATACTCAGA
GCATTGTTCAGCTGGTACAGAGGTACCGAAGTGGCATCCGAGGCCACATGAAGGCTGTGGTGATGGATCT
GCTCCGGCAGTACCTGCGAGTAGAGACACAATTCCAGAATGGTCACTATGACAAATGTGTATTCGCCCTC
CGAGAAGAGAATAAAAGTGACATGAACACTGTACTGAACTACATCTTCTCTCACGCTCAAGTCACCAAGA
AGAATCTTCTGGTCACAATGCTTATTGATCAGTTGTGTGGCCGGGACCCTACTCTCACTGATGAGCTGCT
GAATATTCTCACAGAGCTAACTCAACTCAGTAAGACCACCAATGCCAAAGTAGCACTTCGAGCACGCCAG
GTTCTTATTGCCTCCCATTTGCCATCATATGAGCTTCGCCATAACCAAGTAGAGTCTATCTTCCTATCAG
CTATTGACATGTATGGACATCAATTTTGCATTGAGAACCTGCAGAAACTCATCCTATCAGAAACATCTAT
TTTTGATGTCCTACCAAACTTCTTCTATCACAGCAACCAAGTAGTGAGGATGGCAGCTCTGGAGGTGTAT
GTTCGAAGGGCTTATATTGCCTATGAACTTAACAGCGTACAACACCGCCAGCTTAAGGACAACACCTGTG
TGGTGGAATTCCAGTTCATGCTGCCCACATCTCATCCAAACAGAGGGAACATCCCTACGCTAAACAGAAT
GTCCTTCTCCTCCAACCTCAACCACTATGGCATGACCCATGTAGCTAGTGTCAGCGATGTACTGTTGGAC
AACTCATTCACTCCACCTTGTCAGCGGATGGGCGGAATGGTCTCTTTTCGGACTTTTGAAGATTTTGTCA
GGATCTTTGATGAAGTGATGGGCTGCTTCTCTGACTCCCCACCCCAGAGTCCCACATTCCCTGAGGCAGG
TCACACGTCTCTTTATGATGAGGATAAGGTTCCCAGGGATGAACCAATTCACATTCTCAATGTGGCTATC
AAGACTGACTGTGATATTGAGGATGACAGGCTGGCAGCTATGTTCAGAGAATTTACCCAGCAAAATAAAG
CTACCCTGGTTGACCATGGGATCCGGCGCCTTACTTTCCTGGTTGCACAAAAGGATTTCAGAAAGCAGGT
CAACTATGAGGTGGATCGGAGATTTCATAGAGAATTCCCTAAATTTTTTACATTCCGAGCAAGGGATAAG
TTTGAGGAGGATCGTATCTATCGTCATCTGGAGCCTGCTCTGGCTTTCCAGTTAGAGCTGAACCGGATGA
GAAATTTTGACCTCACTGCCATTCCATGTGCTAATCACAAGATGCACCTGTATCTCGGGGCAGCCAAGGT
GGAAGTGGGCACAGAAGTGACAGACTACAGGTTCTTTGTTCGTGCAATCATCAGGCATTCTGATCTGGTC
ACCAAGGAAGCTTCTTTTGAATATCTGCAAAATGAAGGGGAGCGGCTACTCCTGGAAGCCATGGATGAGT
TGGAAGTTGCTTTTAACAATACAAATGTCCGCACTGACTGTAACCACATCTTCCTCAACTTTGTGCCCAC
GGTTATCATGGACCCATCAAAGATTGAGGAATCCGTGCGGAGCATGGTAATGCGGTATGGAAGTCGCCTG
TGGAAATTGCGCGTCCTCCAGGCAGAACTGAAAATCAACATTCGCCTGACGCCAACTGGAAAAGCAATTC
CCATCCGCCTCTTCCTGACAAACGAGTCTGGCTATTACTTGGATATCAGCCTATACAAGGAAGTGACTGA
CTCCAGGACAGCACAGATCATGTTTCAGGCATATGGAGACAAACAGGGACCACTGCATGGAATGTTAATC
AATACTCCATATGTGACCAAAGACCTGCTGCAATCAAAGAGGTTCCAGGCACAATCCTTAGGGACAACAT
ACATATATGATATCCCAGAGATGTTTCGGCAGTCCCTGATCAAACTCTGGGAGTCTATGTCCACTCAAGC
ATTTCTTCCATCTCCCCCTCTGCCTTCTGACATGCTGACTTACACTGAACTGGTACTGGATGATCAAGGT
CAGCTGGTCCACATGAACAGGCTTCCAGGAGGAAATGAGATTGGCATGGTAGCTTGGAAAATGACCTTTA
AAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGACATCACATACCGAATTGGGTC
CTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCCGAACTTGCTAGGGCAGAAGGTATTCCACGC
ATCTATGTATCAGCCAACAGTGGAGCAAGAATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGG
CCTGGGTAGATCCTGAGGATCCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAAGATTATAAGAG
AGTCAGTGCTCTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACA
GATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATTGCTGGAGAAT
CCTCATTGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGGGCCATTGGGATTGGGGCTTA
CCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAATTCTCACTTAATTCTAACAGGAGCTGGAGCC
CTCAACAAAGTCCTCGGGCGGGAAGTGTACACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCACA
ACAATGGGGTGACCCACTGCACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTC
TTACATGCCCAAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATC
GAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCACCCAACCCAAA
AAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATTATGCAGCCCTGGGCACAGAC
TGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTGGGAGTTGTTGCTGTAGAAACCCGAACAGTA
GAACTAAGTATCCCAGCTGATCCAGCAAACCTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGG
TTTGGTTCCCAGATTCTGCGTTTAAGACGTATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCT
GATGGTCTTTGCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTT
GGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCTCCCCAGGCTG
AGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGGCACATGGAGATGTATGCTGA
CCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACAGTAGAAATCAAATTCCGCAGAAAGGATCTG
GTGAAAACCATGCGTCGGGTGGACCCAGTCTACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAA
GCACAGCTGAGCGGAAGGAGTTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATTCCCATTTACCA
TCAGGTAGCCGTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGC
GATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTGCTGGAGGACC
TGGTCAAGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAGATTCAAGCCATGTTAAGGCG
CTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTTTGGGACAATAATAAGGATCTGGCGGAGTGG
CTAGAGAAACAGCTGACAGAGGAGGATGGTGTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGCA
GAGACTACGTCCTCAAGCAAATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCAT
CCATATGACGCAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCC
CCTTCCACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218293 representing NM_198834
Red=Cloning site Green=Tags(s)

MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEI
SNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVA
SPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMAD
HYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDK
IASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKAS
EGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRR
HQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVA
DVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSS
GTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEY
LIKLLETESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPA
HTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDR
YRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVK
RPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPF
FSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIAN
ILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFAL
REENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQ
VLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVY
VRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLD
NSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAI
KTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDK
FEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLV
TKEASFEYLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRL
WKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLI
NTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPR
IYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKIT
DIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGA
LNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPIDRII
EFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTV
ELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDL
VKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVIS
DILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEW
LEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDS
PST

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_198834
ORF Size 7149 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198834.1, NM_198834.2, NP_942131
RefSeq Size 10018
RefSeq ORF 7152
Locus ID 31
Cytogenetics 17q12
Protein Families Druggable Genome
Protein Pathways Fatty acid biosynthesis, Pyruvate metabolism, Propanoate metabolism, Metabolic pathways, Insulin signaling pathway
MW 269.8 kDa
Gene Summary Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)