FOXE1 (NM_004473) Human Tagged ORF Clone

CAT#: RC218249

FOXE1 (Myc-DDK-tagged)-Human forkhead box E1 (thyroid transcription factor 2) (FOXE1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOXE1 (NM_004473) Human Tagged ORF Clone
Symbol FOXE1
Synonyms FKHL15; FOXE2; HFKH4; HFKL5; TITF2; TTF-2; TTF2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC218249 representing NM_004473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGCCGAGAGCGGGCCGCCGCCGCCGCAGCCGGAGGTGCTGGCTACCGTGAAGGAAGAGCGCGGCG
AGACGGCAGCAGGGGCCGGGGTCCCAGGGGAGGCCACGGGCCGCGGGGCGGGCGGGCGGCGCCGCAAGCG
CCCCCTGCAGCGCGGGAAGCCGCCCTACAGCTACATCGCGCTCATCGCCATGGCCATCGCGCACGCGCCC
GAGCGCCGCCTCACGCTGGGCGGCATCTACAAGTTCATCACCGAGCGCTTCCCCTTCTACCGCGACAACC
CCAAAAAGTGGCAGAACAGCATCCGCCACAACCTCACACTCAACGACTGCTTCCTCAAGATCCCGCGCGA
GGCCGGCCGCCCGGGTAAGGGCAACTACTGGGCGCTTGACCCCAACGCGGAGGACATGTTCGAGAGCGGC
AGCTTCCTGCGCCGCCGCAAGCGCTTCAAGCGCTCGGACCTCTCCACCTACCCGGCTTACATGCACGACG
CGGCGGCTGCCGCAGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCATCTTCCCAGGCGCGGTGCCCGC
CGCGCGCCCCCCCTACCCGGGCGCCGTCTATGCAGGCTACGCGCCGCCGTCGCTGGCCGCGCCGCCTCCA
GTCTACTACCCCGCGGCGTCGCCCGGCCCTTGCCGCGTCTTCGGCCTGGTTCCTGAGCGGCCGCTCAGCC
CAGAGCTGGGGCCCGCACCGTCGGGGCCCGGCGGCTCTTGCGCCTTTGCCTCCGCCGGCGCCCCCGCTAC
CACCACCGGCTACCAGCCCGCAGGCTGCACCGGGGCCCGGCCGGCCAACCCCTCCGCCTATGCGGCTGCC
TACGCGGGCCCCGACGGCGCGTACCCGCAGGGCGCCGGCAGTGCGATCTTTGCCGCTGCTGGCCGCCTGG
CGGGACCCGCTTCGCCCCCAGCGGGCGGCAGCAGTGGCGGCGTGGAGACCACGGTGGACTTCTACGGGCG
CACGTCGCCCGGCCAGTTCGGAGCGCTGGGAGCCTGCTACAACCCTGGCGGGCAGCTCGGAGGGGCCAGT
GCAGGCGCCTACCATGCTCGCCATGCTGCCGCTTATCCCGGTGGGATAGATCGGTTCGTGTCCGCCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218249 representing NM_004473
Red=Cloning site Green=Tags(s)

MTAESGPPPPQPEVLATVKEERGETAAGAGVPGEATGRGAGGRRRKRPLQRGKPPYSYIALIAMAIAHAP
ERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMFESG
SFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAAAAAAIFPGAVPAARPPYPGAVYAGYAPPSLAAPPP
VYYPAASPGPCRVFGLVPERPLSPELGPAPSGPGGSCAFASAGAPATTTGYQPAGCTGARPANPSAYAAA
YAGPDGAYPQGAGSAIFAAAGRLAGPASPPAGGSSGGVETTVDFYGRTSPGQFGALGACYNPGGQLGGAS
AGAYHARHAAAYPGGIDRFVSAM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004473
ORF Size 1119 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004473.2, NM_004473.3, NP_004464
RefSeq Size 3473
RefSeq ORF 1122
Locus ID 2304
Cytogenetics 9q22.33
Protein Families Transcription Factors, Druggable Genome
MW 37.9 kDa
Gene Summary This intronless gene encodes a protein that belongs to the forkhead family of transcription factors. Members of this family contain a conserved 100-amino acid DNA-binding 'forkhead' domain. The encoded protein functions as a thyroid transcription factor that plays a role in thyroid morphogenesis. Mutations in this gene are associated with the Bamforth-Lazarus syndrome, and with susceptibility to nonmedullary thyroid cancer-4. [provided by RefSeq, Nov 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations